VNN2 Antibody - C-terminal region (ARP61815_P050)

Catalog No: ARP61815_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-VNN2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 89%; Horse: 86%; Human: 100%; Pig: 93%; Sheep: 86%; Zebrafish: 75%
• Peptide Sequence: Synthetic peptide located within the following region: FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VNN2 (ARP61815_P050) antibody is Catalog # AAP61815 (Previous Catalog # AAPP48068)

Target Info

• Gene Symbol: VNN2
• Gene Full Name: Vanin 2
• Alias Symbols: FOAP-4, GPI-80
• NCBI Gene Id: 8875
• Protein Name: Vascular non-inflammatory molecule 2
• Description of Target: This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Uniprot ID: O95498
• Protein Accession #: NP_004656
• Nucleotide Accession #: NM_004665
• Protein Size (# AA): 520
• Molecular Weight: 57kDa
• Protein Interactions: ITGB2;