website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

VIM antibody - N-terminal region (ARP48225_P050)

Description of Target:
Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express VIM.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-VIM antibody: synthetic peptide directed towards the N terminal of human VIM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
VIM antibody - N-terminal region (ARP48225_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Sheep, Human, Guinea pig, Dog, Horse, Rabbit, Rat, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-VIM antibody
- ARP48225_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Blocking Peptide:
For anti-VIM antibody is Catalog # AAP48225 (Previous Catalog # AAPS22911)
Target Reference:
Dawson,S.J. (2008) Biochemistry 47 (18), 5127-5138
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for VIM Antibody (ARP48225_P050) tested with pFA fixed COS-7 cells in Immunohistochemistry

CAT# ARP48225_P050

VIM antibody

VIM antibody Immunohistochemistry

VIM antibody COS-7 cells

submitted by:
Carl Lundin
Stanford University

"The Vimentin antibody ARP48225_P050 works well for visualization of the vimentin cytoskeleton (see attached images). We used PFA-fixed COS-7 cells and an antibody dilution of 1:400."

Computational species homology for VIM antibody (ARP48225)

Product page for VIM antibody (ARP48225)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog VIM1 antibody; Xenopus laevis VIM1 antibody P24789 78%
African clawed frog vim1 antibody; Xenopus laevis vim1 antibody Q7ZXC6 78%
African clawed frog VIM4 antibody; Xenopus laevis VIM4 antibody P24790 78%
African clawed frog vim4 antibody; Xenopus laevis vim4 antibody Q7ZX54 78%
African clawed frog vim-b antibody; Xenopus laevis vim-b antibody Q7SZ33 78%
African elephant LOC100672039 antibody; Loxodonta africana LOC100672039 antibody G3TK83 100%
Bovine VIME antibody; Bos taurus VIME antibody P48616 100%
Chicken VIM antibody; Gallus gallus VIM antibody Q49MC1 85%
Chicken VIM antibody; Gallus gallus VIM antibody F1NXT0 85%
Chicken VIM antibody; Gallus gallus VIM antibody F1NJ08 85%
Chicken VIM antibody; Gallus gallus VIM antibody F1NFH3 85%
Chicken VIME antibody; Gallus gallus VIME antibody P09654 85%
Chimpanzee VIM antibody; Pan troglodytes VIM antibody G2HJ38 100%
Chimpanzee VIME antibody; Pan troglodytes VIME antibody Q5R1W8 100%
Chinese hamster Vim antibody; Cricetulus griseus Vim antibody G3HHR3 100%
Chinese hamster VIME antibody; Cricetulus griseus VIME antibody P48670 100%
Crab-eating macaque VIME antibody; Macaca fascicularis VIME antibody Q4R4X4 100%
Dog VIM antibody; Canis familiaris VIM antibody F1PLS4 100%
Golden hamster VIME antibody; Mesocricetus auratus VIME antibody P02544 100%
Gray short-tailed opossum LOC100020416 antibody; Monodelphis domestica LOC100020416 antibody F6SFE6 100%
Green anole VIM antibody; Anolis carolinensis VIM antibody G1KDR6 85%
Green monkey VIME antibody; Chlorocebus aethiops VIME antibody P84198 100%
Guinea pig Vim antibody; Cavia porcellus Vim antibody H0UVC5 100%
Guinea pig Vim antibody; Cavia porcellus Vim antibody B5A9S3 100%
Horse VIM antibody; Equus caballus VIM antibody F7B5C4 100%
Human VIM antibody; Homo sapiens VIM antibody Q53HU8 100%
Human VIM antibody; Homo sapiens VIM antibody F5H288 100%
Human VIM antibody; Homo sapiens VIM antibody B0YJC4 100%
Human VIME antibody; Homo sapiens VIME antibody P08670 100%
Little brown bat VIM antibody; Myotis lucifugus VIM antibody G1PTV1 100%
Lowland gorilla VIM antibody; Gorilla gorilla gorilla VIM antibody G3R2A8 100%
Mouse Vim antibody; Mus musculus Vim antibody Q5FWJ3 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3V2S4 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3UD36 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3UAX1 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3U6S1 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3TWV0 100%
Mouse Vim antibody; Mus musculus Vim antibody Q3TFD9 100%
Mouse Vim antibody; Mus musculus Vim antibody E9PZV5 100%
Mouse Vim antibody; Mus musculus Vim antibody A4IF59 100%
Mouse VIME antibody; Mus musculus VIME antibody P20152 100%
Pig LOC100522394 antibody; Sus scrofa LOC100522394 antibody F1RWC0 100%
Rabbit VIM antibody; Oryctolagus cuniculus VIM antibody G1SWS9 100%
Rat Vim antibody; Rattus norvegicus Vim antibody G3V8C3 100%
Rat VIME antibody; Rattus norvegicus VIME antibody P31000 100%
Rhesus macaque Mmu.17546 antibody; Macaca mulatta Mmu.17546 antibody F7EIV0 100%
Rhesus macaque Mmu.17546 antibody; Macaca mulatta Mmu.17546 antibody F7EIU5 100%
Sheep VIME antibody; Ovis aries VIME antibody Q9MZA9 92%
Western clawed frog vim antibody; Xenopus tropicalis vim antibody Q5M8K3 78%
Western clawed frog vim antibody; Xenopus tropicalis vim antibody B5DES2 78%
Western clawed frog vim antibody; Xenopus tropicalis vim antibody A4IGY5 78%
White-tufted-ear marmoset LOC100408168 antibody; Callithrix jacchus LOC100408168 antibody F7DRE5 100%
White-tufted-ear marmoset LOC100408168 antibody; Callithrix jacchus LOC100408168 antibody F7C5Q6 100%
White-tufted-ear marmoset LOC100408168 antibody; Callithrix jacchus LOC100408168 antibody F7BQY8 100%
White-tufted-ear marmoset LOC100408168 antibody; Callithrix jacchus LOC100408168 antibody F6QRI5 100%
Zebra finch VIM antibody; Taeniopygia guttata VIM antibody H0YST2 85%

Product Protocols: VIM antibody tested with Human Fetal Brain Tissue (ARP48225_P050)

Aviva Systems Biology is the original manufacturer of this VIM antibody (ARP48225_P050)

Click here to view the VIM antibody Western Blot Protocol

Product Datasheet Link: VIM antibody (ARP48225_P050)

WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:

Description of Target: Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s VIM antibody (ARP48225_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: VIM antibody – N-terminal region (ARP48225_P050) with mouse brain extracts, rat brain extract in western blot

VIM antibody - N-terminal region (ARP48225_P050)

Sample Type: 2. mouse brain extracts (80ug)
3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science

Additional protocol details: 2N HCL 30 min, washed in 3x PBS, stained for 1 hour and 30 minutes, with 1 ug/50 ul antibody and incubated in Alexa goat anti-rabbit 594 for 1 hour. Images taken with a 40x objective.

Product Review: VIM antibody-N-terminal region (ARP48225_P050) in Human brain stem cells using IHC

Product Page for VIM antibody - N-terminal region (ARP48225_P050)

Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: IHC
Species+tissue/cell type: Human brain stem cells
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa-Fluor 594
Secondary antibody dilution: 1:1000

IHC Protocol:
Incubate cells with 2N HCL for 30 min
Wash 3X in PBS
Stained for 1h 30 min with 1:500 antibody
Wash 3X in PBS
Incubated with goat anti-rabbit Alexa-Fluor 594 for 1h
Wash 3X in PBS
Co stain with DAPI
Images were taken with a 40X objective

Ask a Question