website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

VIM antibody - N-terminal region (ARP48225_P050)

Scroll Horizontally to view all Images
Print Page
100 ul
In Stock

Conjugation Options

ARP48225_P050-FITC Conjugated

ARP48225_P050-HRP Conjugated

ARP48225_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-32322 from Santa Cruz Biotechnology.
Description of Target:
Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VIM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VIM.
The immunogen is a synthetic peptide directed towards the N terminal region of human VIM
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-VIM (ARP48225_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-VIM (ARP48225_P050) antibody is Catalog # AAP48225 (Previous Catalog # AAPS22911)
Datasheets / Downloads:
Printable datasheet for anti-VIM (ARP48225_P050) antibody
Target Reference:
Dawson,S.J. (2008) Biochemistry 47 (18), 5127-5138

Customer Reviews for VIM Antibody (ARP48225_P050) tested with pFA fixed COS-7 cells in Immunohistochemistry

CAT# ARP48225_P050

VIM antibody

VIM antibody Immunohistochemistry

VIM antibody COS-7 cells

submitted by:
Carl Lundin
Stanford University

"The Vimentin antibody ARP48225_P050 works well for visualization of the vimentin cytoskeleton (see attached images). We used PFA-fixed COS-7 cells and an antibody dilution of 1:400."

Product Protocols: VIM antibody tested with Human Fetal Brain Tissue (ARP48225_P050)

Aviva Systems Biology is the original manufacturer of this VIM antibody (ARP48225_P050)

Click here to view the VIM antibody Western Blot Protocol

Product Datasheet Link: VIM antibody (ARP48225_P050)

WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:

Description of Target: Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s VIM antibody (ARP48225_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: VIM antibody – N-terminal region (ARP48225_P050) with mouse brain extracts, rat brain extract in western blot

VIM antibody - N-terminal region (ARP48225_P050)

Sample Type: 2. mouse brain extracts (80ug)
3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science

Additional protocol details: 2N HCL 30 min, washed in 3x PBS, stained for 1 hour and 30 minutes, with 1 ug/50 ul antibody and incubated in Alexa goat anti-rabbit 594 for 1 hour. Images taken with a 40x objective.

Product Review: VIM antibody-N-terminal region (ARP48225_P050) in Human brain stem cells using IHC

Product Page for VIM antibody - N-terminal region (ARP48225_P050)

Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: IHC
Species+tissue/cell type: Human brain stem cells
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa-Fluor 594
Secondary antibody dilution: 1:1000

IHC Protocol:
Incubate cells with 2N HCL for 30 min
Wash 3X in PBS
Stained for 1h 30 min with 1:500 antibody
Wash 3X in PBS
Incubated with goat anti-rabbit Alexa-Fluor 594 for 1h
Wash 3X in PBS
Co stain with DAPI
Images were taken with a 40X objective

Ask a Question