website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

VIM antibody - N-terminal region (ARP48225_P050)

Description of Target:
Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express VIM.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-VIM antibody: synthetic peptide directed towards the N terminal of human VIM
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
VIM antibody - N-terminal region (ARP48225_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Sheep, Human, Guinea pig, Dog, Horse, Rabbit, Rat, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-VIM antibody
- ARP48225_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Blocking Peptide:
For anti-VIM antibody is Catalog # AAP48225 (Previous Catalog # AAPS22911)
Key Reference:
Dawson,S.J. (2008) Biochemistry 47 (18), 5127-5138
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-VIM antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question