SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57482_P050
Price: $0.00
SKU
ARP57482_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

UVSSA Antibody - C-terminal region (ARP57482_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-UVSSA (ARP57482_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human UVSSA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV
Concentration0.5 mg/ml
Blocking PeptideFor anti-UVSSA (ARP57482_P050) antibody is Catalog # AAP57482
Gene SymbolUVSSA
Gene Full NameUV-stimulated scaffold protein A
Alias SymbolsUVSS3, KIAA1530
NCBI Gene Id57654
Protein NameUV-stimulated scaffold protein A
Description of TargetThe protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.
Uniprot IDQ2YD98
Protein Accession #XP_006713960
Protein Size (# AA)709
Molecular Weight77kDa
Protein InteractionsSIRT1; SETD1A; USP7; GTF2H1; ERCC3; ERCC2; DDB1; ERCC8; CDK7; UBC;
  1. What is the species homology for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UVSSA Antibody - C-terminal region (ARP57482_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    This target may also be called "UVSS3, KIAA1530" in publications.

  5. What is the shipping cost for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "77kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UVSSA Antibody - C-terminal region (ARP57482_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UVSSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UVSSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UVSSA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UVSSA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UVSSA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UVSSA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UVSSA Antibody - C-terminal region (ARP57482_P050)
Your Rating