USP9Y Antibody - C-terminal region (ARP59337_P050)

Catalog No: ARP59337_P050

WB Suggested Anti-USP9Y Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human USP9Y
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-USP9Y (ARP59337_P050) antibody is Catalog # AAP59337 (Previous Catalog # AAPP45435)
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Gene Symbol: USP9Y
• Gene Full Name: Ubiquitin specific peptidase 9, Y-linked
• Alias Symbols: DFFRY, SPGFY2
• NCBI Gene Id: 8287
• Protein Name: Probable ubiquitin carboxyl-terminal hydrolase FAF-Y
• Description of Target: This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins.
• Uniprot ID: O00507
• Protein Accession #: NP_004645
• Nucleotide Accession #: NM_004654
• Protein Size (# AA): 2555
• Molecular Weight: 291 kDa
• Protein Interactions: CSNK1E; UBC; SHC1; SIRT1; PMS1; MAPT;