- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
UPF3B Antibody - N-terminal region (ARP40998_T100)
Datasheets/Manuals | Printable datasheet for anti-UPF3B (ARP40998_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UPF3B |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-UPF3B (ARP40998_T100) antibody is Catalog # AAP40998 (Previous Catalog # AAPP22424) |
Reference | Lehner,B. (2004) Genome Res. 14 (7), 1315-1323 |
Publications | Premature termination codon readthrough in human cells occurs in novel cytoplasmic foci and requires UPF proteins. J Cell Sci. 130, 3009-3022 (2017). 28743738 RNA sequencing of synaptic and cytoplasmic Upf1-bound transcripts supports contribution of nonsense-mediated decay to epileptogenesis. Sci Rep. 7, 41517 (2017). 28128343 |
Description |
Gene Symbol | UPF3B |
---|---|
Gene Full Name | UPF3 regulator of nonsense transcripts homolog B (yeast) |
Alias Symbols | MRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, Upf3p-X |
NCBI Gene Id | 65109 |
Protein Name | Regulator of nonsense transcripts 3B |
Description of Target | UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctionsThis gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. |
Uniprot ID | Q9BZI7 |
Protein Accession # | NP_075386 |
Nucleotide Accession # | NM_023010 |
Protein Size (# AA) | 470 |
Molecular Weight | 52kDa |
Protein Interactions | NCBP1; CIAO1; STAU1; UBC; UPF1; HECW2; RBM8A; UPF2; SMG1; EIF4A3; WIBG; WBP11; RNPS1; SART1; TOP2A; SNRPA1; NXF1; CAND1; COPS5; CUL5; USP21; EXOSC4; MCRS1; XRN1; TTC19; EIF6; UPF3B; HBB; UPF3A; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Rabbit".
-
How long will it take to receive "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "UPF3B Antibody - N-terminal region (ARP40998_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
This target may also be called "MRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, Upf3p-X" in publications.
-
What is the shipping cost for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "52kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UPF3B Antibody - N-terminal region (ARP40998_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UPF3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UPF3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UPF3B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UPF3B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UPF3B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UPF3B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.