ULK3 Antibody - middle region (ARP58971_P050)

Catalog No: ARP58971_P050

WB Suggested Anti-ULK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ULK3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ULK3 (ARP58971_P050) antibody is Catalog # AAP58971 (Previous Catalog # AAPP44939)

Target Info

• Gene Symbol: ULK3
• Gene Full Name: Unc-51-like kinase 3 (C. elegans)
• Alias Symbols: DKFZp434C131, FLJ90566
• NCBI Gene Id: 25989
• Protein Name: Serine/threonine-protein kinase ULK3
• Description of Target: ULK3 is the serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. ULK3 may exert this function by promoting GLI1 nuclear localization. ULK3 phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.
• Uniprot ID: Q6PHR2
• Protein Accession #: NP_001092906
• Nucleotide Accession #: NM_001099436
• Protein Size (# AA): 472
• Molecular Weight: 53kDa
• Protein Interactions: VCP; WDR82; UBC;