SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63203_P050
Price: $0.00
SKU
ARP63203_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-UCP1 (ARP63203_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 91%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: AMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMD
Concentration0.5 mg/ml
Blocking PeptideFor anti-UCP1 (ARP63203_P050) antibody is Catalog # AAP63203
Sample Type Confirmation

UCP1 is supported by BioGPS gene expression data to be expressed in A549

Gene SymbolUCP1
Gene Full NameUncoupling protein 1 (mitochondrial, proton carrier)
Alias SymbolsUCP, SLC25A7
NCBI Gene Id7350
Protein NameMitochondrial brown fat uncoupling protein 1
Description of TargetMitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat.
Uniprot IDP25874
Protein Accession #NP_068605
Nucleotide Accession #NM_021833
Protein Size (# AA)307
Molecular Weight34kDa
Protein InteractionsCIDEA; TOMM20;
  1. What is the species homology for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep".

  2. How long will it take to receive "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UCP1 Antibody - C-terminal region (ARP63203_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    This target may also be called "UCP, SLC25A7" in publications.

  5. What is the shipping cost for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UCP1 Antibody - C-terminal region (ARP63203_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UCP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UCP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UCP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UCP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UCP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UCP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UCP1 Antibody - C-terminal region (ARP63203_P050)
Your Rating
We found other products you might like!