UBN1 Antibody - C-terminal region (ARP47638_P050)

Catalog No: ARP47638_P050

WB Suggested Anti-UBN1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysateUBN1 is supported by BioGPS gene expression data to be expressed in HeLa

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UBN1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBN1 (ARP47638_P050) antibody is Catalog # AAP47638 (Previous Catalog # AAPP28495)
• Sample Type Confirmation:

  UBN1 is supported by BioGPS gene expression data to be expressed in HeLa

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: UBN1
• Gene Full Name: Ubinuclein 1
• Alias Symbols: VT, VT4
• NCBI Gene Id: 29855
• Protein Name: Ubinuclein-1
• Description of Target: UBN1 may be required for replication-independent chromatin assembly.
• Uniprot ID: Q9NPG3
• Protein Accession #: NP_058632
• Nucleotide Accession #: NM_016936
• Protein Size (# AA): 1134
• Molecular Weight: 121kDa
• Protein Interactions: PPP1CA; WDR36; ZNF606; TJP2; ASF1A; CABIN1; HIRA; POLR2A; H3F3A; TJP1;