website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TYR antibody - middle region (ARP44269_T100)

Description of Target:
TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
Gene Symbol:
Official Gene Full Name:
Tyrosinase (oculocutaneous albinism IA)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TYR.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
TYR antibody - middle region (ARP44269_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 93%; Guinea pig: 92%; Bovine: 86%; Zebrafish: 83%
Species Reactivity:
Sheep, Rat, Dog, Horse, Goat, Pig, Human, Mouse, Rabbit, Guinea pig, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-TYR antibody
- ARP44269_T100
Peptide Sequence:
Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Blocking Peptide:
For anti-TYR antibody is Catalog # AAP44269 (Previous Catalog # AAPP25649)
Key Reference:
Bidinost,C., (2006) Invest. Ophthalmol. Vis. Sci. 47 (4), 1486-1490
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-TYR antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question