website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TYR antibody - middle region (ARP44269_T100)

Description of Target:
TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
Gene Symbol:
Official Gene Full Name:
Tyrosinase (oculocutaneous albinism IA)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TYR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TYR.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
TYR antibody - middle region (ARP44269_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 93%; Guinea pig: 92%; Bovine: 86%; Zebrafish: 83%
Species Reactivity:
Sheep, Rat, Dog, Horse, Goat, Pig, Human, Mouse, Rabbit, Guinea pig, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-TYR antibody
- ARP44269_T100
Peptide Sequence:
Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Blocking Peptide:
For anti-TYR antibody is Catalog # AAP44269 (Previous Catalog # AAPP25649)
Target Reference:
Bidinost,C., (2006) Invest. Ophthalmol. Vis. Sci. 47 (4), 1486-1490
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: TYR antibody tested with Human Jurkat Cells (ARP44269_T100)

Aviva Systems Biology is the original manufacturer of this TYR antibody (ARP44269_T100)

Click here to view the TYR antibody Western Blot Protocol

Product Datasheet Link: TYR antibody (ARP44269_T100)

WB Suggested Anti-TYR Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TYR antibody (ARP44269_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question