website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TYR antibody - middle region (ARP44269_T100)

Description of Target:
TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
Gene Symbol:
Official Gene Full Name:
Tyrosinase (oculocutaneous albinism IA)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TYR.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
TYR antibody - middle region (ARP44269_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 93%; Guinea pig: 92%; Bovine: 86%; Zebrafish: 83%
Species Reactivity:
Sheep, Rat, Dog, Horse, Goat, Pig, Human, Mouse, Rabbit, Guinea pig, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-TYR antibody
- ARP44269_T100
Peptide Sequence:
Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Blocking Peptide:
For anti-TYR antibody is Catalog # AAP44269 (Previous Catalog # AAPP25649)
Target Reference:
Bidinost,C., (2006) Invest. Ophthalmol. Vis. Sci. 47 (4), 1486-1490
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TYR antibody (ARP44269)

Product page for TYR antibody (ARP44269)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100676924 antibody; Loxodonta africana LOC100676924 antibody G3TGJ7 100%
Asian house shrew TYR antibody; Suncus murinus TYR antibody B5UA08 85%
Asian house shrew TYR antibody; Suncus murinus TYR antibody B5UA07 85%
Atlantic salmon LOC100136546 antibody; Salmo salar LOC100136546 antibody Q19VI0 91%
Black-spotted frog TYRO antibody; Pelophylax nigromaculatus TYRO antibody Q04604 91%
Bovine TYR antibody; Bos taurus TYR antibody F1MBK3 85%
Bovine TYRO antibody; Bos taurus TYRO antibody Q8MIU0 85%
Cat TYR antibody; Felis catus TYR antibody Q2VPV8 100%
Cat TYRO antibody; Felis catus TYRO antibody P55033 100%
Channel catfish LOC100304491 antibody; Ictalurus punctatus LOC100304491 antibody Q9PTB2 78%
Chicken TYR antibody; Gallus gallus TYR antibody Q9PSV0 85%
Chicken TYR antibody; Gallus gallus TYR antibody Q91436 85%
Chicken TYRO antibody; Gallus gallus TYRO antibody P55024 85%
Dog Cfa.104 antibody; Canis familiaris Cfa.104 antibody F1PSM7 100%
Dog TYRO antibody; Canis familiaris TYRO antibody P54834 100%
Duckbill platypus TYR antibody; Ornithorhynchus anatinus TYR antibody F7F2U4 92%
European domestic ferret TYR antibody; Mustela putorius furo TYR antibody A4L2N2 100%
European toad tyr antibody; Bufo bufo tyr antibody B6VPX8 100%
gold crucian carp tyr antibody; Carassius auratus auratus tyr antibody B7X728 91%
Gray short-tailed opossum TYR antibody; Monodelphis domestica TYR antibody F6YHC5 92%
Green anole LOC100552257 antibody; Anolis carolinensis LOC100552257 antibody G1KQJ9 91%
Guinea pig LOC100713552 antibody; Cavia porcellus LOC100713552 antibody H0VH99 91%
Horse TYR antibody; Equus caballus TYR antibody F6YIA2 100%
Human TYRO antibody; Homo sapiens TYRO antibody P14679 100%
Lowland gorilla TYR antibody; Gorilla gorilla gorilla TYR antibody G3R159 100%
Lowland gorilla TYRO antibody; Gorilla gorilla gorilla TYRO antibody Q9BDE0 100%
Medaka fish TYRO antibody; Oryzias latipes TYRO antibody P55025 91%
Mouse Tyr antibody; Mus musculus Tyr antibody Q91XK0 100%
Mouse Tyr antibody; Mus musculus Tyr antibody Q64ID7 100%
Mouse Tyr antibody; Mus musculus Tyr antibody Q3UFR6 100%
Mouse Tyr antibody; Mus musculus Tyr antibody Q3UFQ7 100%
Mouse Tyr antibody; Mus musculus Tyr antibody Q3UFK9 100%
Mouse Tyr antibody; Mus musculus Tyr antibody E9PYH7 100%
Mouse TYRO antibody; Mus musculus TYRO antibody P11344 100%
Northern white-cheeked gibbon TYR antibody; Nomascus leucogenys TYR antibody G1S1X1 100%
Pig TYR antibody; Sus scrofa TYR antibody Q4R1H3 100%
Rabbit TYR antibody; Oryctolagus cuniculus TYR antibody Q9MYI7 92%
Rainbow trout tyr antibody; Oncorhynchus mykiss tyr antibody Q762J0 78%
Rainbow trout tyrb antibody; Oncorhynchus mykiss tyrb antibody Q75W62 91%
Rat Tyr antibody; Rattus norvegicus Tyr antibody D4A9G4 100%
Rhesus macaque TYR antibody; Macaca mulatta TYR antibody F6TZA2 100%
Sheep TYR antibody; Ovis aries TYR antibody A7LK11 100%
Three-spined stickleback TYR (2 of 2) antibody; Gasterosteus aculeatus TYR (2 of 2) antibody G3NYX7 83%
Three-spined stickleback TYR (2 of 2) antibody; Gasterosteus aculeatus TYR (2 of 2) antibody G3NYW9 83%
Western clawed frog tyr antibody; Xenopus tropicalis tyr antibody F7CL37 91%
Western clawed frog tyr antibody; Xenopus tropicalis tyr antibody A4QNF6 91%
White-tufted-ear marmoset LOC100399713 antibody; Callithrix jacchus LOC100399713 antibody F7CFZ0 87%
Zebra finch LOC100225893 antibody; Taeniopygia guttata LOC100225893 antibody H0ZRN9 85%
Zebrafish tyr antibody; Danio rerio tyr antibody Q8AYA1 83%
Zebrafish tyr antibody; Danio rerio tyr antibody F1QJ80 83%
Zebrafish tyr antibody; Danio rerio tyr antibody F1QDZ4 83%

Product Protocols: TYR antibody tested with Human Jurkat Cells (ARP44269_T100)

Aviva Systems Biology is the original manufacturer of this TYR antibody (ARP44269_T100)

Click here to view the TYR antibody Western Blot Protocol

Product Datasheet Link: TYR antibody (ARP44269_T100)

WB Suggested Anti-TYR Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TYR antibody (ARP44269_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question