website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TUBB3 antibody - C-terminal region (ARP63783_P050)

  • Catalog#: ARP63783_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    TUBB3
    NCBI Gene Id:
    10381
    Official Gene Full Name:
    Tubulin, beta 3 class III
    Protein Name:
    Tubulin beta-3 chain
    Swissprot Id:
    Q13509
    Protein Accession #:
    NP_006077
    Nucleotide Accession #:
    NM_006086
    Alias Symbols:
    CFEOM3A, MC1R, TUBB4, beta-4, CDCBM
    Description of Target:
    This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
    Protein Size (# AA):
    450
    Molecular Weight:
    50kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TUBB3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TUBB3.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 90%
    Complete computational species homology data:
    Anti-TUBB3 (ARP63783_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; HAUS2; CEP250; MAPT; EMD; EML1; ASB18; ASB8; ASB17; ASB4; rev; PAPSS1; VCL; RARS; MSN; STK26; CAPZB; CAPZA1; ACAT2; FBXO6; EGFR; CD81; HDAC6; SOX2; NPM1; IQCB1; TPTE; FAM86B2; METTL23; CAMKMT; VCPKMT; METTL22; METTL21B; PEX14; GZMK; TUBA1C; MDN1; TUB
    Blocking Peptide:
    For anti-TUBB3 (ARP63783_P050) antibody is Catalog # AAP63783
    Datasheets / Downloads:
    Printable datasheet for anti-TUBB3 (ARP63783_P050) antibody
     
    X
    Ask a Question