website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TUBB3 antibody - C-terminal region (ARP63783_P050)

Description of Target:
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Gene Symbol:
TUBB3
Official Gene Full Name:
Tubulin, beta 3 class III
NCBI Gene Id:
10381
Alias Symbols:
CFEOM3A; MC1R; TUBB4; beta-4; CDCBM
Tissue Tool:
Find tissues and cell lines supported to express TUBB3.
Protein Accession #:
NP_006077
Nucleotide Accession#:
NM_006086
Swissprot Id:
Q13509
Host:
Rabbit
Protein Name:
Tubulin beta-3 chain
Protein Size (# AA):
450
Molecular Weight:
50kDa
Application:
WB
Partner Proteins:
ARHGEF7,CAMSAP3,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,LIG1,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,TF,ARHGEF7,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,STAU1,TF,UBC
Product Format:
Lyophilized powder
Complete computational species homology data:
TUBB3 antibody - C-terminal region (ARP63783_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Yeast: 90%
Species Reactivity:
Human, Pig, Dog, Horse, Rabbit, Guinea pig, Bovine, Rat, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-TUBB3 antibody
- ARP63783_P050
Peptide Sequence:
Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Blocking Peptide:
For anti-TUBB3 antibody is Catalog # AAP63783
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TUBB3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question