TUBB3 antibody - C-terminal region (ARP63783_P050)

Catalog#: ARP63783_P050

• Size: 50ug

Human Fetal Brain

• Description of Target: This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
• Gene Symbol: TUBB3
• Official Gene Full Name: Tubulin, beta 3 class III
• Alias Symbols: CFEOM3A; MC1R; TUBB4; beta-4; CDCBM
• Protein Accession#: NP_006077
• Nucleotide Accession#: NM_006086
• Swissprot Id: Q13509
• Host: Rabbit
• Protein Size (# AA): 450
• Molecular Weight: 50kDa
• Application: WB
• Partner Proteins: ARHGEF7,CAMSAP3,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,LIG1,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,TF,ARHGEF7,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,STAU1,TF,UBC
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Dog: 100%; Human: 100%; Mouse: 92%
• Peptide Sequence: Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
• Blocking Peptide: For anti-TUBB3 antibody is Catalog # AAP63783
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TUBB3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.