website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

TUBB3 antibody - C-terminal region (ARP63783_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Tubulin, beta 3 class III
    Protein Name:
    Tubulin beta-3 chain
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    CFEOM3A, MC1R, TUBB4, beta-4, CDCBM
    Description of Target:
    This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TUBB3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TUBB3.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 90%
    Complete computational species homology data:
    Anti-TUBB3 (ARP63783_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-TUBB3 (ARP63783_P050) antibody is Catalog # AAP63783
    Datasheets / Downloads:
    Printable datasheet for anti-TUBB3 (ARP63783_P050) antibody
    Ask a Question