website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TUBB3 antibody - C-terminal region (ARP63783_P050)

Description of Target:
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Gene Symbol:
Official Gene Full Name:
Tubulin, beta 3 class III
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TUBB3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TUBB3.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Tubulin beta-3 chain
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-TUBB3 (ARP63783_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Yeast: 90%
Species Reactivity:
Human, Pig, Dog, Horse, Rabbit, Guinea pig, Bovine, Rat, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for anti-TUBB3 (ARP63783_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Blocking Peptide:
For anti-TUBB3 (ARP63783_P050) antibody is Catalog # AAP63783
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Ask a Question