website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TUBB3 antibody - C-terminal region (ARP63783_P050)

Description of Target:
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Gene Symbol:
TUBB3
Official Gene Full Name:
Tubulin, beta 3 class III
NCBI Gene Id:
10381
Alias Symbols:
CFEOM3A; MC1R; TUBB4; beta-4; CDCBM
Tissue Tool:
Find tissues and cell lines supported to express TUBB3.
Protein Accession #:
NP_006077
Nucleotide Accession#:
NM_006086
Swissprot Id:
Q13509
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Tubulin beta-3 chain
Protein Size (# AA):
450
Molecular Weight:
50kDa
Application:
WB
Partner Proteins:
ARHGEF7,CAMSAP3,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,LIG1,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,TF,ARHGEF7,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,STAU1,TF,UBC
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TUBB3 antibody - C-terminal region (ARP63783_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Yeast: 90%
Species Reactivity:
Human, Pig, Dog, Horse, Rabbit, Guinea pig, Bovine, Rat, Mouse, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-TUBB3 antibody
- ARP63783_P050
Peptide Sequence:
Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Blocking Peptide:
For anti-TUBB3 antibody is Catalog # AAP63783
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TUBB3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TUBB3 antibody (ARP63783)

Product page for TUBB3 antibody (ARP63783)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog tubb3 antibody; Xenopus laevis tubb3 antibody Q5U5A4 100%
African elephant LOC100671690 antibody; Loxodonta africana LOC100671690 antibody G3SNF2 100%
Atlantic salmon tbb3 antibody; Salmo salar tbb3 antibody B5X3H7 90%
Bovine TBB3 antibody; Bos taurus TBB3 antibody Q2T9S0 100%
Carrot TBB1 antibody; Daucus carota TBB1 antibody P20364 83%
Chicken TBB4 antibody; Gallus gallus TBB4 antibody P09652 85%
Crab-eating macaque TBB3 antibody; Macaca fascicularis TBB3 antibody Q60HC2 100%
Dog Cfa.39503 antibody; Canis familiaris Cfa.39503 antibody F2Z4P1 100%
Dog TUBB3 antibody; Canis familiaris TUBB3 antibody Q9N0F8 100%
Duckbill platypus TUBB3 antibody; Ornithorhynchus anatinus TUBB3 antibody F6TMY6 92%
Gray short-tailed opossum LOC100027632 antibody; Monodelphis domestica LOC100027632 antibody F6ZPR1 92%
Green anole TP53INP1 antibody; Anolis carolinensis TP53INP1 antibody G1KCH6 90%
Guinea pig LOC100732882 antibody; Cavia porcellus LOC100732882 antibody H0UYF4 100%
Horse LOC100629183 antibody; Equus caballus LOC100629183 antibody F6QD28 100%
Human TBB3 antibody; Homo sapiens TBB3 antibody Q13509 100%
Human TUBB3 antibody; Homo sapiens TUBB3 antibody Q9BV28 100%
Human TUBB3 antibody; Homo sapiens TUBB3 antibody Q53G92 100%
Human TUBB3 antibody; Homo sapiens TUBB3 antibody A8K854 100%
Lowland gorilla ENSG00000198211 antibody; Gorilla gorilla gorilla ENSG00000198211 antibody G3RVT2 100%
Lowland gorilla ENSG00000198211 antibody; Gorilla gorilla gorilla ENSG00000198211 antibody G3QIE8 100%
Mouse TBB3 antibody; Mus musculus TBB3 antibody Q9ERD7 92%
Mouse Tubb3 antibody; Mus musculus Tubb3 antibody Q9CRT0 92%
Northern white-cheeked gibbon ENSG00000198211 antibody; Nomascus leucogenys ENSG00000198211 antibody G1S1K0 100%
Northern white-cheeked gibbon TUBB3 antibody; Nomascus leucogenys TUBB3 antibody G1S1K2 100%
Pig LOC100620928 antibody; Sus scrofa LOC100620928 antibody F1S6M7 100%
Rat TBB3 antibody; Rattus norvegicus TBB3 antibody Q4QRB4 92%
Rhesus macaque Mmu.8572 antibody; Macaca mulatta Mmu.8572 antibody F6QAX2 100%
Small-eared galago TUBB3 antibody; Otolemur garnettii TUBB3 antibody H0XN74 92%
strain VCD115 / DSM 17065 / LMG 22923 def antibody; Deinococcus deserti def antibody C1D077 81%
Western clawed frog tubb3 antibody; Xenopus tropicalis tubb3 antibody Q6P1T8 91%
Western clawed frog tubb3 antibody; Xenopus tropicalis tubb3 antibody F6V2D7 91%
Western clawed frog tubb3 antibody; Xenopus tropicalis tubb3 antibody F6Q7Z6 91%
 
X
Ask a Question