website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TUBB3 antibody - C-terminal region (ARP63783_P050)

Scroll Horizontally to view all Images
Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP63783_P050-FITC Conjugated

ARP63783_P050-HRP Conjugated

ARP63783_P050-Biotin Conjugated

Gene Symbol:
TUBB3
NCBI Gene Id:
10381
Official Gene Full Name:
Tubulin, beta 3 class III
Protein Name:
Tubulin beta-3 chain
Swissprot Id:
Q13509
Protein Accession #:
NP_006077
Nucleotide Accession #:
NM_006086
Alias Symbols:
CFEOM3A, MC1R, TUBB4, beta-4, CDCBM
Replacement Item:
This antibody may replace item sc-105009 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Protein Size (# AA):
450
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TUBB3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TUBB3.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 90%
Complete computational species homology data:
Anti-TUBB3 (ARP63783_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; HAUS2; CEP250; MAPT; EMD; EML1; ASB18; ASB8; ASB17; ASB4; rev; PAPSS1; VCL; RARS; MSN; STK26; CAPZB; CAPZA1; ACAT2; FBXO6; EGFR; CD81; HDAC6; SOX2; NPM1; IQCB1; TPTE; FAM86B2; METTL23; CAMKMT; VCPKMT; METTL22; METTL21B; PEX14; GZMK; TUBA1C; MDN1; TUB
Blocking Peptide:
For anti-TUBB3 (ARP63783_P050) antibody is Catalog # AAP63783
Datasheets / Downloads:
Printable datasheet for anti-TUBB3 (ARP63783_P050) antibody
 
X
Ask a Question