website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TST antibody - middle region (ARP42122_P050)

Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Gene Symbol:
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
NCBI Gene Id:
Alias Symbols:
MGC19578; RDS
Tissue Tool:
Find tissues and cell lines supported to express TST.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Thiosulfate sulfurtransferase
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TST antibody: synthetic peptide directed towards the middle region of human TST
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TST antibody - middle region (ARP42122_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Horse, Rabbit, Bovine, Rat, Mouse, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TST antibody
- ARP42122_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Blocking Peptide:
For anti-TST antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Key Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TST antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question