website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TST antibody - middle region (ARP42122_P050)

Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Gene Symbol:
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
NCBI Gene Id:
Alias Symbols:
MGC19578; RDS
Tissue Tool:
Find tissues and cell lines supported to express TST.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Thiosulfate sulfurtransferase
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TST antibody: synthetic peptide directed towards the middle region of human TST
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TST antibody - middle region (ARP42122_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Horse, Rabbit, Bovine, Rat, Mouse, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TST antibody
- ARP42122_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Blocking Peptide:
For anti-TST antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TST antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TST antibody (ARP42122)

Product page for TST antibody (ARP42122)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100670934 antibody; Loxodonta africana LOC100670934 antibody G3SRJ8 100%
Bovine THTR antibody; Bos taurus THTR antibody P00586 100%
Chicken THTR antibody; Gallus gallus THTR antibody P25324 84%
Chicken TST antibody; Gallus gallus TST antibody F1NMH6 84%
Chicken TST antibody; Gallus gallus TST antibody F1NDP5 84%
Chinese hamster THTR antibody; Cricetulus griseus THTR antibody P46635 100%
Dog TST antibody; Canis familiaris TST antibody E2RJF4 100%
Duckbill platypus TST antibody; Ornithorhynchus anatinus TST antibody F7FVM0 85%
Gray short-tailed opossum LOC100025213 antibody; Monodelphis domestica LOC100025213 antibody F6W6H5 76%
Green anole LOC100557496 antibody; Anolis carolinensis LOC100557496 antibody G1KS95 85%
Guinea pig LOC100720246 antibody; Cavia porcellus LOC100720246 antibody H0VWC2 92%
Horse LOC100054655 antibody; Equus caballus LOC100054655 antibody F6ULU1 100%
Human THTR antibody; Homo sapiens THTR antibody Q16762 100%
Human TST antibody; Homo sapiens TST antibody Q53EW8 100%
Human TST antibody; Homo sapiens TST antibody E7EN05 100%
Little brown bat TST antibody; Myotis lucifugus TST antibody G1QD95 100%
Mouse THTR antibody; Mus musculus THTR antibody P52196 100%
Mouse Tst antibody; Mus musculus Tst antibody Q545S0 100%
Mouse Tst antibody; Mus musculus Tst antibody D3YYT7 100%
Northern white-cheeked gibbon LOC100596182 antibody; Nomascus leucogenys LOC100596182 antibody G1RXB9 100%
Pig TST antibody; Sus scrofa TST antibody F1SKL2 92%
Rabbit LOC100343713 antibody; Oryctolagus cuniculus LOC100343713 antibody G1TIC9 100%
Rat THTR antibody; Rattus norvegicus THTR antibody P24329 100%
Rhesus macaque TST antibody; Macaca mulatta TST antibody F7ENR1 100%
Rhesus macaque TST antibody; Macaca mulatta TST antibody F7EJU8 100%
Rice Os07g0666900 antibody; Oryza sativa subsp. japonica Os07g0666900 antibody Q0D3T8 90%
Rice OsNHX1 antibody; Oryza sativa subsp. japonica OsNHX1 antibody Q9SXJ8 90%
Small-eared galago TST antibody; Otolemur garnettii TST antibody H0XX63 92%
Small-eared galago TST antibody; Otolemur garnettii TST antibody H0XFE1 92%
Tasmanian devil TST antibody; Sarcophilus harrisii TST antibody G3WLQ1 84%

Product Protocols: TST antibody tested by IHC with human lung (ARP42122)

Aviva Systems Biology is the original manufacturer of this TST antibody.

Click here to view the TST antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TST antibody (ARP42122)

IHC Information:

Rabbit Anti-TST Antibody
Catalog Number: ARP42122
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question