website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TST antibody - middle region (ARP42122_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $235.00

In Stock

Conjugation Options

ARP42122_P050-FITC Conjugated

ARP42122_P050-HRP Conjugated

ARP42122_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
Protein Name:
Thiosulfate sulfurtransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC19578, RDS
Replacement Item:
This antibody may replace item sc-20959 from Santa Cruz Biotechnology.
Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TST.
The immunogen is a synthetic peptide directed towards the middle region of human TST
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TST (ARP42122_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TST (ARP42122_P050) antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Datasheets / Downloads:
Printable datasheet for anti-TST (ARP42122_P050) antibody
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...