website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TST antibody - middle region (ARP42122_P050)

Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
In Stock
Free trial-size samples may be available for this item. Please go here for more information.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
Protein Name:
Thiosulfate sulfurtransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC19578, RDS
Replacement Item:
This antibody may replace item sc-20959 from Santa Cruz Biotechnology.
Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TST.
The immunogen is a synthetic peptide directed towards the middle region of human TST
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TST (ARP42122_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TST (ARP42122_P050) antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Datasheets / Downloads:
Printable datasheet for anti-TST (ARP42122_P050) antibody
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920

Product Protocols: TST antibody tested by IHC with human lung (ARP42122)

Aviva Systems Biology is the original manufacturer of this TST antibody.

Click here to view the TST antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TST antibody (ARP42122)

IHC Information:

Rabbit Anti-TST Antibody
Catalog Number: ARP42122
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question