website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TST antibody - middle region (ARP42122_P050)

Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Gene Symbol:
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
NCBI Gene Id:
Alias Symbols:
MGC19578; RDS
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TST.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Thiosulfate sulfurtransferase
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TST antibody: synthetic peptide directed towards the middle region of human TST
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
TST antibody - middle region (ARP42122_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Horse, Rabbit, Bovine, Rat, Mouse, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TST antibody
- ARP42122_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Blocking Peptide:
For anti-TST antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: TST antibody tested by IHC with human lung (ARP42122)

Aviva Systems Biology is the original manufacturer of this TST antibody.

Click here to view the TST antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TST antibody (ARP42122)

IHC Information:

Rabbit Anti-TST Antibody
Catalog Number: ARP42122
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question