website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

US

TST antibody - middle region (ARP42122_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TST
NCBI Gene Id:
7263
Official Gene Full Name:
Thiosulfate sulfurtransferase (rhodanese)
Protein Name:
Thiosulfate sulfurtransferase
Swissprot Id:
Q16762
Protein Accession #:
NP_003303
Nucleotide Accession #:
NM_003312
Alias Symbols:
MGC19578, RDS
Description of Target:
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Protein Size (# AA):
297
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TST.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TST
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TST (ARP42122_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NEDD8; S100A16; HPDL; SEPT11; SEC22B; SLC9A3R2; AIFM1; UBE2M; SNRPA; PSMD7; PSMB2; UBC; ND1; PRSS1;
Blocking Peptide:
For anti-TST (ARP42122_P050) antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607)
Datasheets / Downloads:
Printable datasheet for anti-TST (ARP42122_P050) antibody
Additional Information:
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920

Product Protocols: TST antibody tested by IHC with human lung (ARP42122)

Aviva Systems Biology is the original manufacturer of this TST antibody.

Click here to view the TST antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TST antibody (ARP42122)

IHC Information:

Rabbit Anti-TST Antibody
Catalog Number: ARP42122
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question