TSKS Antibody - N-terminal region (ARP53748_P050)

Catalog No: ARP53748_P050

WB Suggested Anti-TSKS Antibody Titration: 1 ug/ml
Positive Control: HepG2 cell lysate

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0ug/ml using anti-TSKS antibody (ARP53748_P050)

Human Testis

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human Testis (formalin-fixed, paraffin-embedded) stained with TSKS antibody ARP53748_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
  IHC Information: Human Testis (formalin-fixed, paraffin-embedded) stained with TSKS antibody ARP53748_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSKS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TSKS (ARP53748_P050) antibody is Catalog # AAP53748 (Previous Catalog # AAPP30839)
• Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Target Info

• Gene Symbol: TSKS
• Gene Full Name: Testis-specific serine kinase substrate
• Alias Symbols: TSKS1, TSSKS, STK22S1, PPP1R161
• NCBI Gene Id: 60385
• Protein Name: Testis-specific serine kinase substrate
• Description of Target: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.
• Uniprot ID: Q9UJT2
• Protein Accession #: NP_068379
• Nucleotide Accession #: NM_021733
• Protein Size (# AA): 592
• Molecular Weight: 65kDa
• Protein Interactions: PPP1CA; SF3A3; SF3A1; USP10; APP; TSSK2;