TRPM4 Antibody - N-terminal region (ARP35268_P050)

Catalog No: ARP35268_P050

Host: Rat
Target Name: TRPM4
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRPM4 (ARP35268_P050) antibody is Catalog # AAP35268 (Previous Catalog # AAPP06506)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Park,J.Y., (2008) Biochem. Biophys. Res. Commun. 368 (3), 677-683
• Publications:

  Age-dependent decrease in TRPM4 channel expression but not trafficking alters urinary bladder smooth muscle contractility. Physiol Rep. 9, e14754 (2021). 33625779

  Kuras, Z., Yun, Y.-H., Chimote, A. A., Neumeier, L. & Conforti, L. KCa3.1 and TRPM7 channels at the uropod regulate migration of activated human T cells. PLoS One 7, e43859 (2012). 22952790

• Description:
  View product citations for TRPM4 Antibody - N-terminal region (ARP35268_P050) on CiteAb

Target Info

• Gene Symbol: TRPM4
• Gene Full Name: Transient receptor potential cation channel, subfamily M, member 4
• Alias Symbols: EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4
• NCBI Gene Id: 54795
• Protein Name: Transient receptor potential cation channel subfamily M member 4
• Description of Target: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. TRPM4 is involved in myogenic constriction of cerebral arteries. It controls insulin secretion in pancreatic beta-cells. TRPM4 may also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca2+ overload.
• Uniprot ID: Q8TD43
• Protein Accession #: NP_060106
• Nucleotide Accession #: NM_017636
• Protein Size (# AA): 1214
• Molecular Weight: 134 kDa
• Protein Interactions: FUS; UBC; TRPM4;