- Description of Target:
- TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
- Gene Symbol:
- TRMU
- Official Gene Full Name:
- TRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
- Alias Symbols:
- MGC99627; MTO2; MTU1; TRMT; TRMT1; TRNT1
- Tissue Tool:
- Find tissues and cell lines supported to express TRMU.
- Protein Accession# :
- NP_060476
- Nucleotide Accession#:
- NM_018006
- Swissprot Id:
- O75648
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 421
- Molecular Weight:
- 48kDa
- Application:
- WB
- Partner Proteins:
- GPN1, POLR3D, POLR3H, RAE1, RPAP1, RPAP2
- Immunogen:
- The immunogen for anti-TRMU antibody: synthetic peptide directed towards the C terminal of human TRMU
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- TRMU antibody - C-terminal region (ARP48819_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Dog: 92%; Horse: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-TRMU antibody
- ARP48819_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP
- Blocking Peptide:
- For anti-TRMU antibody is Catalog # AAP48819 (Previous Catalog # AAPP28869)
- Key Reference:
- Guan,M.X., (2006) Am. J. Hum. Genet. 79 (2), 291-302
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-TRMU antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: TRMU antibody tested with Human Hela Cells (ARP48819_P050)
Aviva Systems Biology is the original manufacturer of this TRMU antibody (ARP48819_P050)
Click here to view the TRMU antibody Western Blot Protocol
Product Datasheet Link: TRMU antibody (ARP48819_P050)
WB Suggested Anti-TRMU Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela
Western Blot image: 
Description of Target: TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s TRMU antibody (ARP48819_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
