website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TRIM47 antibody - middle region (ARP34650_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
TRIM47
Official Gene Full Name:
Tripartite motif containing 47
NCBI Gene Id:
91107
Alias Symbols:
GOA; RNF100
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIM47.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIM47.
Swissprot Id:
Q96LD4
Protein Accession #:
NP_258411
Nucleotide Accession #:
NM_033452
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Tripartite motif-containing protein 47
Protein Size (# AA):
638
Molecular Weight:
69kDa
Application:
WB
Protein Interactions:
TNS3; DNPEP; ANKS1A; GANAB; NUDT5; CUL1; TPP2; PTPN12; PPP1R12A; UBC; APP; UBD; TRIM8; TSG101; TERF2; UBE2U;
Immunogen:
The immunogen for anti-TRIM47 antibody: synthetic peptide directed towards the middle region of human TRIM47
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
TRIM47 antibody - middle region (ARP34650_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Rat, Bovine, Pig, Horse, Rabbit, Guinea pig, Human
Datasheets / Downloads:
Printable datasheet for
anti-TRIM47 antibody
- ARP34650_P050
Peptide Sequence:
Synthetic peptide located within the following region: DLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRG
Blocking Peptide:
For anti-TRIM47 antibody is Catalog # AAP34650 (Previous Catalog # AAPP23626)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: TRIM47 antibody tested with Human Thp-1 Cells (ARP34650_P050)

Aviva Systems Biology is the original manufacturer of this TRIM47 antibody (ARP34650_P050)

Click here to view the TRIM47 antibody Western Blot Protocol

Product Datasheet Link: TRIM47 antibody (ARP34650_P050)

WB Suggested Anti-TRIM47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1

Western Blot image:


Description of Target: The function of this protein remains unknown.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TRIM47 antibody (ARP34650_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question