website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRIM47 antibody - middle region (ARP34650_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Tripartite motif containing 47
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TRIM47.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tripartite motif-containing protein 47
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TRIM47 antibody: synthetic peptide directed towards the middle region of human TRIM47
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
TRIM47 antibody - middle region (ARP34650_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Rat, Bovine, Pig, Horse, Rabbit, Guinea pig, Human
Datasheets / Downloads:
Printable datasheet for
anti-TRIM47 antibody
- ARP34650_P050
Peptide Sequence:
Synthetic peptide located within the following region: DLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRG
Blocking Peptide:
For anti-TRIM47 antibody is Catalog # AAP34650 (Previous Catalog # AAPP23626)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TRIM47 antibody (ARP34650)

Product page for TRIM47 antibody (ARP34650)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant TRIM47 antibody; Loxodonta africana TRIM47 antibody G3SU13 100%
Bovine TRIM47 antibody; Bos taurus TRIM47 antibody E1BG23 100%
Common turkey TRIM47 antibody; Meleagris gallopavo TRIM47 antibody G1MZH0 85%
Dog TRIM47 antibody; Canis familiaris TRIM47 antibody F1P7Y1 92%
Duckbill platypus TRIM47 antibody; Ornithorhynchus anatinus TRIM47 antibody F7AXW5 100%
Duckbill platypus TRIM47 antibody; Ornithorhynchus anatinus TRIM47 antibody F7AXU9 100%
Gray short-tailed opossum TRIM47 antibody; Monodelphis domestica TRIM47 antibody F7BKB4 100%
Green anole TRIM47 antibody; Anolis carolinensis TRIM47 antibody G1KGR1 92%
Guinea pig TRIM47 antibody; Cavia porcellus TRIM47 antibody H0VHE4 100%
Horse TRIM47 antibody; Equus caballus TRIM47 antibody F6YJP4 100%
Human TRI47 antibody; Homo sapiens TRI47 antibody Q96LD4 100%
Human TRIM47 antibody; Homo sapiens TRIM47 antibody Q96AD0 100%
Little brown bat TRIM47 antibody; Myotis lucifugus TRIM47 antibody G1PR15 100%
Lowland gorilla TRIM47 antibody; Gorilla gorilla gorilla TRIM47 antibody G3SBG4 100%
Lowland gorilla TRIM47 antibody; Gorilla gorilla gorilla TRIM47 antibody G3R1F9 100%
Mouse TRI47 antibody; Mus musculus TRI47 antibody Q8C0E3 100%
Mouse TRI47 antibody; Mus musculus TRI47 antibody Q8C0E3-2 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody Q7TMQ8 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody Q66JW4 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody Q497Z1 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody B7ZN75 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody A3KMJ7 100%
Mouse Trim47 antibody; Mus musculus Trim47 antibody A2A861 100%
Northern white-cheeked gibbon TRIM47 antibody; Nomascus leucogenys TRIM47 antibody G1QMF3 100%
Pig TRIM47 antibody; Sus scrofa TRIM47 antibody F1RVZ0 100%
Rabbit TRIM47 antibody; Oryctolagus cuniculus TRIM47 antibody G1SRG2 100%
Rabbit TRIM47 antibody; Oryctolagus cuniculus TRIM47 antibody G1SQF8 100%
Rat Trim47 antibody; Rattus norvegicus Trim47 antibody D3ZA22 100%
Rhesus macaque TRIM47 antibody; Macaca mulatta TRIM47 antibody F7HF49 100%
Small-eared galago TRIM47 antibody; Otolemur garnettii TRIM47 antibody H0WJP2 100%
Tasmanian devil TRIM47 antibody; Sarcophilus harrisii TRIM47 antibody G3VI29 100%
White-tufted-ear marmoset TRIM47 antibody; Callithrix jacchus TRIM47 antibody F6ZEA2 100%
White-tufted-ear marmoset TRIM47 antibody; Callithrix jacchus TRIM47 antibody F6ZE80 100%
Zebra finch TRIM65 antibody; Taeniopygia guttata TRIM65 antibody H0ZD31 85%

Product Protocols: TRIM47 antibody tested with Human Thp-1 Cells (ARP34650_P050)

Aviva Systems Biology is the original manufacturer of this TRIM47 antibody (ARP34650_P050)

Click here to view the TRIM47 antibody Western Blot Protocol

Product Datasheet Link: TRIM47 antibody (ARP34650_P050)

WB Suggested Anti-TRIM47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1

Western Blot image:

Description of Target: The function of this protein remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TRIM47 antibody (ARP34650_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question