website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRIM47 antibody - middle region (ARP34650_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Tripartite motif containing 47
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TRIM47.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tripartite motif-containing protein 47
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TRIM47 antibody: synthetic peptide directed towards the middle region of human TRIM47
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TRIM47 antibody - middle region (ARP34650_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Rat, Bovine, Pig, Horse, Rabbit, Guinea pig, Human
Datasheets / Downloads:
Printable datasheet for
anti-TRIM47 antibody
- ARP34650_P050
Peptide Sequence:
Synthetic peptide located within the following region: DLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRG
Blocking Peptide:
For anti-TRIM47 antibody is Catalog # AAP34650 (Previous Catalog # AAPP23626)
Key Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRIM47 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question