website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRIM21 antibody - C-terminal region (ARP38248_T100)

Description of Target:
TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Tripartite motif containing 21
NCBI Gene Id:
Alias Symbols:
RNF81; RO52; SSA; SSA1
Tissue Tool:
Find tissues and cell lines supported to express TRIM21.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
E3 ubiquitin-protein ligase TRIM21
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TRIM21 antibody: synthetic peptide directed towards the C terminal of human TRIM21
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
TRIM21 antibody - C-terminal region (ARP38248_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 92%; Pig: 85%; Rat: 77%; Bovine: 77%; Zebrafish: 77%; Guinea pig: 77%
Species Reactivity:
Human, Horse, Pig, Zebrafish, Bovine, Rat, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TRIM21 antibody
- ARP38248_T100
Peptide Sequence:
Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
Blocking Peptide:
For anti-TRIM21 antibody is Catalog # AAP38248 (Previous Catalog # AAPP23102)
Target Reference:
Yamochi,T., (2008) Biochem. Biophys. Res. Commun. 370 (1), 195-199
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TRIM21 antibody (ARP38248)

Product page for TRIM21 antibody (ARP38248)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Guinea pig TRIM21 antibody; Cavia porcellus TRIM21 antibody H0VKV8 76%
Horse TRIM21 antibody; Equus caballus TRIM21 antibody F7ADG7 92%
Human RO52 antibody; Homo sapiens RO52 antibody P19474 100%
Human RO52 antibody; Homo sapiens RO52 antibody P19474-2 100%
Human TRIM21 antibody; Homo sapiens TRIM21 antibody F5H012 100%
Little brown bat TRIM21 antibody; Myotis lucifugus TRIM21 antibody G1P0S5 76%
Lowland gorilla TRIM21 antibody; Gorilla gorilla gorilla TRIM21 antibody G3QUH3 100%
Northern white-cheeked gibbon TRIM21 antibody; Nomascus leucogenys TRIM21 antibody G1S6A6 92%
Pig TRIM21 antibody; Sus scrofa TRIM21 antibody F1RHN8 84%
Pig TRIM21 antibody; Sus scrofa TRIM21 antibody C7E3P9 84%
Rhesus macaque TRIM21 antibody; Macaca mulatta TRIM21 antibody F7C1A0 92%
Rhesus macaque TRIM21 antibody; Macaca mulatta TRIM21 antibody F6ZU58 92%
White-tufted-ear marmoset TRIM21 antibody; Callithrix jacchus TRIM21 antibody F7ASY1 84%
White-tufted-ear marmoset TRIM21 antibody; Callithrix jacchus TRIM21 antibody F7ALH2 84%

Product Protocols: TRIM21 antibody tested with Human Transfected 293T Cells (ARP38248_T100)

Aviva Systems Biology is the original manufacturer of this TRIM21 antibody (ARP38248_T100)

Click here to view the TRIM21 antibody Western Blot Protocol

Product Datasheet Link: TRIM21 antibody (ARP38248_T100)

WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T

Western Blot image:

Description of Target: TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TRIM21 antibody (ARP38248_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question