website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRIM21 antibody - C-terminal region (ARP38248_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP38248_T100-FITC Conjugated

ARP38248_T100-HRP Conjugated

ARP38248_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Tripartite motif containing 21
Protein Name:
E3 ubiquitin-protein ligase TRIM21
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
RNF81, RO52, SSA, SSA1
Replacement Item:
This antibody may replace item sc-111343 from Santa Cruz Biotechnology.
Description of Target:
TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIM21.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIM21.
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM21
Species Reactivity:
Cow, Guinea Pig, Horse, Human, Pig, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Pig: 85%; Rat: 77%; Zebrafish: 77%
Complete computational species homology data:
Anti-TRIM21 (ARP38248_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TRIM21 (ARP38248_T100) antibody is Catalog # AAP38248 (Previous Catalog # AAPP23102)
Datasheets / Downloads:
Printable datasheet for anti-TRIM21 (ARP38248_T100) antibody
Target Reference:
Yamochi,T., (2008) Biochem. Biophys. Res. Commun. 370 (1), 195-199

Product Protocols: TRIM21 antibody tested with Human Transfected 293T Cells (ARP38248_T100)

Aviva Systems Biology is the original manufacturer of this TRIM21 antibody (ARP38248_T100)

Click here to view the TRIM21 antibody Western Blot Protocol

Product Datasheet Link: TRIM21 antibody (ARP38248_T100)

WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T

Western Blot image:

Description of Target: TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TRIM21 antibody (ARP38248_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...