website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

TRIM21 antibody - C-terminal region (ARP38248_T100)

Description of Target:
TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
TRIM21
Official Gene Full Name:
Tripartite motif containing 21
NCBI Gene Id:
6737
Alias Symbols:
RNF81; RO52; SSA; SSA1
Tissue Tool:
Find tissues and cell lines supported to express TRIM21.
Protein Accession #:
NP_003132
Nucleotide Accession#:
NM_003141
Swissprot Id:
P19474
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
E3 ubiquitin-protein ligase TRIM21
Protein Size (# AA):
475
Molecular Weight:
54kDa
Application:
WB
Partner Proteins:
HNF1A, CHD1, CHMP1B, CSNK2A1, DHX9, EXOSC10, MCM4, MYCBP, NEK9, RAN, ROBO2, SFRS12, SPI1, SRF, AIRE, CHD1, Chd1, Chd1, MYCBP, NEK9, SRF
Immunogen:
The immunogen for anti-TRIM21 antibody: synthetic peptide directed towards the C terminal of human TRIM21
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
TRIM21 antibody - C-terminal region (ARP38248_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 92%; Pig: 85%; Rat: 77%; Bovine: 77%; Zebrafish: 77%; Guinea pig: 77%
Species Reactivity:
Human, Horse, Pig, Zebrafish, Bovine, Rat, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TRIM21 antibody
- ARP38248_T100
Peptide Sequence:
Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
Blocking Peptide:
For anti-TRIM21 antibody is Catalog # AAP38248 (Previous Catalog # AAPP23102)
Key Reference:
Yamochi,T., (2008) Biochem. Biophys. Res. Commun. 370 (1), 195-199
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-TRIM21 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question