website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TRAPPC2 antibody - middle region (ARP50568_P050)

Description of Target:
TRAPPC2 prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. TRAPPC2 may play a role in vesicular transport from endoplasmic reticulum to Golgi.The protein encoded by this gene is thought to be part of a large multisubunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind MBP1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseuodogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been found for this gene.
Gene Symbol:
TRAPPC2
Official Gene Full Name:
Trafficking protein particle complex 2
NCBI Gene Id:
6399
Alias Symbols:
MIP-2A; SEDL; SEDT; TRS20; ZNF547L; hYP38334; MIP2A; TRAPPC2P1
Tissue Tool:
Find tissues and cell lines supported to express TRAPPC2.
Protein Accession #:
NP_055378
Nucleotide Accession#:
NM_014563
Swissprot Id:
O14582
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
140
Molecular Weight:
16kDa
Application:
WB
Subunit:
2
Partner Proteins:
HDAC1, HDAC9, IKZF1, IKZF4, MAD1L1, MXD1, MXI1, REST, SETDB1, ZBTB16, HCFC1, HDAC1, HDAC9, IKZF1, IKZF2, IKZF3, IKZF4, MECP2, RNF220, SAP30, SETDB1, SUDS3, WHSC1, ZBTB16
Immunogen:
The immunogen for anti-TRAPPC2 antibody: synthetic peptide directed towards the middle region of human TRAPPC2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TRAPPC2 antibody - middle region (ARP50568_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%
Species Reactivity:
Dog, Pig, Horse, Human, Rat, Guinea pig, Bovine, Mouse, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-TRAPPC2 antibody
- ARP50568_P050
Peptide Sequence:
Synthetic peptide located within the following region: RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLL
Blocking Peptide:
For anti-TRAPPC2 antibody is Catalog # AAP50568 (Previous Catalog # AAPP13941)
Key Reference:
Ross,M.T., (2005) Nature 434 (7031), 325-337
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRAPPC2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question