TNNT3 Antibody - N-terminal region (ARP51287_T100)

Catalog No: ARP51287_T100

WB Suggested Anti-TNNT3 Antibody Titration: 1.25ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
• Concentration: 1.0 mg/ml
• Blocking Peptide: Catalog # AAP51287 (Previous Catalog # AAPS22402)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Robinson,P., (2007) FASEB J. 21 (3), 896-905
• Publications:

  Calpain inhibition rescues troponin T3 fragmentation, increases Cav1.1, and enhances skeletal muscle force in aging sedentary mice. Aging Cell. 15, 488-98 (2016). 26892246

  Troponin T3 regulates nuclear localization of the calcium channel Cavβ1a subunit in skeletal muscle. Exp Cell Res. 336, 276-86 (2015). 25981458

  Zhang, T., Birbrair, A. & Delbono, O. Nonmyofilament-associated troponin T3 nuclear and nucleolar localization sequence and leucine zipper domain mediate muscle cell apoptosis. Cytoskeleton (Hoboken). 70, 134-47 (2013). 23378072

• Description:
  View product citations for TNNT3 Antibody - N-terminal region (ARP51287_T100) on CiteAb

Target Info

• Gene Symbol: TNNT3
• Gene Full Name: Troponin T type 3 (skeletal, fast)
• Alias Symbols: TNTF, DA2B2, beta-TnTF
• NCBI Gene Id: 7140
• Protein Name: Troponin T, fast skeletal muscle
• Description of Target: Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
• Uniprot ID: P45378-4
• Protein Accession #: NP_001036245
• Nucleotide Accession #: NM_001042780
• Protein Size (# AA): 269
• Molecular Weight: 32 kDa
• Protein Interactions: TNNC1; TPM1; TNNI2; TNNC2; TNNT3; NUDT3; TSG101; TRIM63; SNUPN; HAP1;