Catalog No: P100705_P050
Price: $0.00
SKU
P100705_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TMF1 (P100705_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TMF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-TMF1 (P100705_P050) antibody is Catalog # AAP31060 (Previous Catalog # AAPP01794)
Sample Type Confirmation

There is BioGPS gene expression data showing that TMF1 is expressed in MCF7

ReferenceYamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485
Description
Gene SymbolTMF1
Gene Full NameTATA element modulatory factor 1
Alias SymbolsTMF, ARA160
NCBI Gene Id7110
Protein NameTATA element modulatory factor
Description of TargetTMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
Uniprot IDP82094
Protein Accession #NP_009045
Nucleotide Accession #NM_007114
Protein Size (# AA)1093
Molecular Weight123kDa
Protein InteractionsUBC; NR3C1; GFI1B; ITSN2; KAT2B; PLK1; SMARCA4; AR; RAB6A; FER;
  1. What is the species homology for "TMF1 Antibody - middle region (P100705_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TMF1 Antibody - middle region (P100705_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TMF1 Antibody - middle region (P100705_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TMF1 Antibody - middle region (P100705_P050)"?

    This target may also be called "TMF, ARA160" in publications.

  5. What is the shipping cost for "TMF1 Antibody - middle region (P100705_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TMF1 Antibody - middle region (P100705_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TMF1 Antibody - middle region (P100705_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "123kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TMF1 Antibody - middle region (P100705_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TMF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TMF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TMF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TMF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TMF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TMF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TMF1 Antibody - middle region (P100705_P050)
Your Rating
We found other products you might like!