Catalog No: ARP42506_P050 (Formerly GWB-MP178G )
Price: $0.00
SKU
ARP42506_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ANO1 (ARP42506_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TMEM16A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
Concentration0.5 mg/ml
Blocking PeptideFor anti-ANO1 (ARP42506_P050) antibody is Catalog # AAP42506 (Previous Catalog # AAPS13008)
ReferenceKatoh,M. (2004) Int. J. Oncol. 24 (5), 1345-1349
Publications

Banga, A., Flaig, S., Lewis, S., Winfree, S. & Blazer-Yost, B. L. Epinephrine stimulation of anion secretion in the Calu-3 serous cell model. Am. J. Physiol. Lung Cell. Mol. Physiol. 306, L937-46 (2014). 24705724

Liu, Y. et al. Characterization of the effects of Cl(-) channel modulators on TMEM16A and bestrophin-1 Ca(2+) activated Cl (-) channels. Pflugers Arch. (2014). doi:10.1007/s00424-014-1572-5 25078708

Gene SymbolANO1
Gene Full NameAnoctamin 1, calcium activated chloride channel
Alias SymbolsDOG1, TAOS2, ORAOV2, TMEM16A
NCBI Gene Id55107
Protein NameAnoctamin-1
Description of TargetTMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.
Uniprot IDQ5XXA6
Protein Accession #NP_060513
Nucleotide Accession #NM_018043
Protein Size (# AA)960
Molecular Weight111kDa
Protein InteractionsUBC;
  1. What is the species homology for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TMEM16A Antibody - middle region (ARP42506_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TMEM16A Antibody - middle region (ARP42506_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    This target may also be called "DOG1, TAOS2, ORAOV2, TMEM16A" in publications.

  5. What is the shipping cost for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "111kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TMEM16A Antibody - middle region (ARP42506_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TMEM16A Antibody - middle region (ARP42506_P050)
Your Rating
We found other products you might like!