TM4SF4 Antibody - N-terminal region (ARP46480_P050)

Catalog No: ARP46480_P050

WB Suggested Anti-TM4SF4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TM4SF4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Guinea Pig: 79%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TM4SF4 (ARP46480_P050) antibody is Catalog # AAP46480 (Previous Catalog # AAPS18610)
• Reference: Strausberg,R.L., J. Cell. Sci. 114 (PT 23), 4143-4151 (2001)

Target Info

• Gene Symbol: TM4SF4
• Gene Full Name: Transmembrane 4 L six family member 4
• Alias Symbols: ILTMP, il-TMP
• NCBI Gene Id: 7104
• Protein Name: Transmembrane 4 L6 family member 4
• Description of Target: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene.
• Uniprot ID: P48230
• Protein Accession #: NP_004608
• Nucleotide Accession #: NM_004617
• Protein Size (# AA): 202
• Molecular Weight: 21kDa
• Protein Interactions: FATE1;