website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TLR9 antibody - N-terminal region (ARP33256_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
TLR9
Official Gene Full Name:
Toll-like receptor 9
NCBI Gene Id:
54106
Alias Symbols:
CD289
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TLR9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TLR9.
Swissprot Id:
Q9NR96
Protein Accession #:
NP_059138
Nucleotide Accession #:
NM_017442
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Toll-like receptor 9
Protein Size (# AA):
1032
Molecular Weight:
113kDa
Application:
WB
Protein Interactions:
SYK; BTK; STK11IP; UNC93B1; UGGT1; TOLLIP; PALD1; TRAF3; CLGN; TRIM69; TBK1; STUB1; TRAF6; SRC; PRKCZ; MYD88; IRAK1; HSPA8; RNF216; SIGIRR; MAPK8IP3; TLR1; HRAS;
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TLR9
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-TLR9 (ARP33256_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Dog: 85%
Species Reactivity:
Bovine, Goat, Human, Sheep, Pig, Horse, Rat, Guinea pig, Rabbit, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for anti-TLR9 (ARP33256_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
Blocking Peptide:
For anti-TLR9 (ARP33256_P050) antibody is Catalog # AAP33256 (Previous Catalog # AAPP04294)
Target Reference:
Kamine,J., (2008) Infect. Immun. 76 (5), 2123-2129
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: TLR9 antibody tested with Human Achn Cells (ARP33256_P050)

Aviva Systems Biology is the original manufacturer of this TLR9 antibody (ARP33256_P050)

Click here to view the TLR9 antibody Western Blot Protocol

Product Datasheet Link: TLR9 antibody (ARP33256_P050)

WB Suggested Anti-TLR9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN

Western Blot image:


Description of Target: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TLR9 antibody (ARP33256_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question