website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TLR9 antibody - N-terminal region (ARP33256_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
TLR9
Official Gene Full Name:
Toll-like receptor 9
NCBI Gene Id:
54106
Alias Symbols:
CD289
Tissue Tool:
Find tissues and cell lines supported to express TLR9.
Protein Accession #:
NP_059138
Nucleotide Accession#:
NM_017442
Swissprot Id:
Q9NR96
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Toll-like receptor 9
Protein Size (# AA):
1032
Molecular Weight:
113kDa
Application:
WB
Immunogen:
The immunogen for anti-TLR9 antibody: synthetic peptide directed towards the N terminal of human TLR9
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TLR9 antibody - N-terminal region (ARP33256_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Dog: 85%
Species Reactivity:
Bovine, Goat, Human, Sheep, Pig, Horse, Rat, Guinea pig, Rabbit, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for
anti-TLR9 antibody
- ARP33256_P050
Peptide Sequence:
Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
Blocking Peptide:
For anti-TLR9 antibody is Catalog # AAP33256 (Previous Catalog # AAPP04294)
Key Reference:
Kamine,J., (2008) Infect. Immun. 76 (5), 2123-2129
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TLR9 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question