website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TLR9 antibody - N-terminal region (ARP33256_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Toll-like receptor 9
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TLR9.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Toll-like receptor 9
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TLR9 antibody: synthetic peptide directed towards the N terminal of human TLR9
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
TLR9 antibody - N-terminal region (ARP33256_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Dog: 85%
Species Reactivity:
Bovine, Goat, Human, Sheep, Pig, Horse, Rat, Guinea pig, Rabbit, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for
anti-TLR9 antibody
- ARP33256_P050
Peptide Sequence:
Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
Blocking Peptide:
For anti-TLR9 antibody is Catalog # AAP33256 (Previous Catalog # AAPP04294)
Target Reference:
Kamine,J., (2008) Infect. Immun. 76 (5), 2123-2129
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TLR9 antibody (ARP33256)

Product page for TLR9 antibody (ARP33256)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Black flying fox TLR9 antibody; Pteropus alecto TLR9 antibody E2DIF2 85%
Bornean orangutan TLR9 antibody; Pongo pygmaeus TLR9 antibody B3Y665 100%
Bovine TLR9 antibody; Bos taurus TLR9 antibody Q5I2M5 100%
Bovine TLR9 antibody; Bos taurus TLR9 antibody Q8HXV0 100%
Bovine TLR9 antibody; Bos taurus TLR9 antibody Q866B2 100%
Bovine TLR9 antibody; Bos taurus TLR9 antibody A5H631 100%
Cat TLR9 antibody; Felis catus TLR9 antibody Q5I2M7 85%
Chimpanzee TLR9 antibody; Pan troglodytes TLR9 antibody B3Y662 100%
Crab-eating macaque TLR9 antibody; Macaca fascicularis TLR9 antibody B3Y666 100%
Dog TLR9 antibody; Canis familiaris TLR9 antibody Q5I2M8 84%
Dog TLR9 antibody; Canis familiaris TLR9 antibody F1Q3P7 84%
Dog TLR9 antibody; Canis familiaris TLR9 antibody Q865B9 76%
Domestic water buffalo TLR9 antibody; Bubalus bubalis TLR9 antibody F1CFG5 100%
Domestic water buffalo TLR9 antibody; Bubalus bubalis TLR9 antibody F1CFG4 100%
Domestic water buffalo TLR9 antibody; Bubalus bubalis TLR9 antibody B9VUV3 100%
Goat TLR9 antibody; Capra hircus TLR9 antibody B3VI23 100%
Guinea pig LOC100724130 antibody; Cavia porcellus LOC100724130 antibody H0W5F7 92%
Horse TLR9 antibody; Equus caballus TLR9 antibody Q2EEY0 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody Q9NR96 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody Q9NR96-5 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody Q9NR96-4 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody Q9NR96-3 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody Q9NR96-2 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody D1CS62 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody D1CS61 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody D1CS56 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody C3W5P5 100%
Human TLR9 antibody; Homo sapiens TLR9 antibody B6CH46 100%
Leschenault rousette TLR9 antibody; Rousettus leschenaultii TLR9 antibody B6ZND0 92%
Lowland gorilla TLR9 antibody; Gorilla gorilla gorilla TLR9 antibody G3RID2 100%
Lowland gorilla TLR9 antibody; Gorilla gorilla gorilla TLR9 antibody G3RIC3 100%
Mouse TLR9 antibody; Mus musculus TLR9 antibody Q9EQU3 85%
Nilgai TLR9 antibody; Boselaphus tragocamelus TLR9 antibody B3VI26 92%
Northern white-cheeked gibbon ENSG00000173366 antibody; Nomascus leucogenys ENSG00000173366 antibody G1R620 100%
Pan troglodytes verus TLR9 antibody D7NVU5 100%
Pan troglodytes verus TLR9 antibody D7NVT9 100%
Pan troglodytes verus TLR9 antibody D7NVT6 100%
Pan troglodytes verus TLR9 antibody D7NVT5 100%
Pan troglodytes verus TLR9 antibody D7NVT4 100%
Pan troglodytes verus TLR9 antibody D7NVT3 100%
Pan troglodytes verus TLR9 antibody D7NVT2 100%
Pig TLR9 antibody; Sus scrofa TLR9 antibody Q5I2M3 100%
Pig TLR9 antibody; Sus scrofa TLR9 antibody Q865R8 100%
Pig TLR9 antibody; Sus scrofa TLR9 antibody Q7YSE0 100%
Pig TLR9 antibody; Sus scrofa TLR9 antibody F1SIX6 100%
Pig TLR9 antibody; Sus scrofa TLR9 antibody D3JEM4 100%
Pygmy chimpanzee TLR9 antibody; Pan paniscus TLR9 antibody B3Y663 100%
Rabbit TLR9 antibody; Oryctolagus cuniculus TLR9 antibody G4VV65 85%
Rat Tlr9 antibody; Rattus norvegicus Tlr9 antibody Q6Y1S0 85%
Rat Tlr9 antibody; Rattus norvegicus Tlr9 antibody Q5I2M6 85%
Rhesus macaque Mmu.3819 antibody; Macaca mulatta Mmu.3819 antibody F6UZJ0 100%
Rhesus macaque TLR9 antibody; Macaca mulatta TLR9 antibody B3Y667 100%
Sheep TLR9 antibody; Ovis aries TLR9 antibody Q5I2M4 100%
Sheep TLR9 antibody; Ovis aries TLR9 antibody D3YC66 100%
Sheep tlr9 antibody; Ovis aries tlr9 antibody B5DC94 100%
Sika deer TLR9 antibody; Cervus nippon TLR9 antibody F1CGS9 100%
western gorilla TLR9 antibody; Gorilla gorilla TLR9 antibody B3Y664 100%
White-tufted-ear marmoset LOC100411708 antibody; Callithrix jacchus LOC100411708 antibody F7HZG7 100%
White-tufted-ear marmoset LOC100411708 antibody; Callithrix jacchus LOC100411708 antibody F7HX66 100%
Zebu TLR 9 antibody; Bos indicus TLR 9 antibody A5H634 100%
Zebu TLR9 antibody; Bos indicus TLR9 antibody B8Y893 100%

Product Protocols: TLR9 antibody tested with Human Achn Cells (ARP33256_P050)

Aviva Systems Biology is the original manufacturer of this TLR9 antibody (ARP33256_P050)

Click here to view the TLR9 antibody Western Blot Protocol

Product Datasheet Link: TLR9 antibody (ARP33256_P050)

WB Suggested Anti-TLR9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN

Western Blot image:

Description of Target: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TLR9 antibody (ARP33256_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question