TLR9 antibody - N-terminal region (ARP33256_P050)

Catalog#: ARP33256_P050

• Size: 50ug

Human ACHN

• Description of Target: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: TLR9
• Official Gene Full Name: Toll-like receptor 9
• Alias Symbols: CD289
• Protein Accession#: NP_059138
• Nucleotide Accession#: NM_017442
• Swissprot Id: Q9NR96
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 1032
• Molecular Weight: 113kDa
• Application: WB
• Immunogen: The immunogen for anti-TLR9 antibody: synthetic peptide directed towards the N terminal of human TLR9
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Goat: 100%; Horse: 100%; Human: 100%; Pig: 100%; Sheep: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Dog: 84%
• Peptide Sequence: Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
• Blocking Peptide: For anti-TLR9 antibody is Catalog # AAP33256 (Previous Catalog # AAPP04294)
• Key Reference: Kamine,J., (2008) Infect. Immun. 76 (5), 2123-2129
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TLR9 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: TLR9 antibody tested with Human Achn Cells (ARP33256_P050)

Aviva Systems Biology is the original manufacturer of this TLR9 antibody (ARP33256_P050)

Click here to view the TLR9 antibody Western Blot Protocol

Product Datasheet Link: TLR9 antibody (ARP33256_P050)

WB Suggested Anti-TLR9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN

Western Blot image:


Description of Target: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TLR9 antibody (ARP33256_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com