SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31753_P050
Price: $0.00
SKU
ARP31753_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TLR5 (ARP31753_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Goat, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TLR5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Goat: 79%; Human: 100%; Pig: 83%; Rat: 79%; Sheep: 79%
Peptide SequenceSynthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Concentration0.5 mg/ml
Blocking PeptideFor anti-TLR5 (ARP31753_P050) antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
ReferenceHume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590
Gene SymbolTLR5
Gene Full NameToll-like receptor 5
Alias SymbolsSLE1, TIL3, SLEB1, MELIOS
NCBI Gene Id7100
Protein NameToll-like receptor 5
Description of TargetTLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO60602
Protein Accession #NP_003259
Nucleotide Accession #NM_003268
Protein Size (# AA)858
Molecular Weight98kDa
Protein InteractionsRNF216; SIGIRR; TLR4; MYD88; TLR1;
  1. What is the species homology for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Goat, Pig, Sheep".

  2. How long will it take to receive "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TLR5 Antibody - N-terminal region (ARP31753_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    This target may also be called "SLE1, TIL3, SLEB1, MELIOS" in publications.

  5. What is the shipping cost for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TLR5 Antibody - N-terminal region (ARP31753_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TLR5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TLR5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TLR5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TLR5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TLR5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TLR5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TLR5 Antibody - N-terminal region (ARP31753_P050)
Your Rating
We found other products you might like!