website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

THG1L antibody - middle region (ARP47819_P050)

Description of Target:
THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.
Gene Symbol:
THG1L
Official Gene Full Name:
TRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
NCBI Gene Id:
54974
Alias Symbols:
FLJ11601; FLJ20546; ICF45
Tissue Tool:
Find tissues and cell lines supported to express THG1L.
Protein Accession #:
NP_060342
Nucleotide Accession#:
NM_017872
Swissprot Id:
Q9NWX6
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Probable tRNA(His) guanylyltransferase
Protein Size (# AA):
298
Molecular Weight:
35kDa
Application:
WB
Partner Proteins:
CG10032, CG13339, CG14764, CG15706, CG2199, CG31140, CG32647, CG34168, CG4068, CG6933, CkIIalpha, Cp16, Ef1alpha48D, Khc, RpS7, lsn, noc
Immunogen:
The immunogen for anti-THG1L antibody: synthetic peptide directed towards the middle region of human THG1L
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
THG1L antibody - middle region (ARP47819_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 91%; Rat: 86%; Guinea pig: 86%; Yeast: 83%; Zebrafish: 83%; Mouse: 79%
Species Reactivity:
Human, Rabbit, Dog, Horse, Bovine, Pig, Rat, Guinea pig, Zebrafish, Yeast, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-THG1L antibody
- ARP47819_P050
Peptide Sequence:
Synthetic peptide located within the following region: DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY
Blocking Peptide:
For anti-THG1L antibody is Catalog # AAP47819 (Previous Catalog # AAPY02034)
Target Reference:
Guo,D., (2004) J. Biol. Chem. 279 (51), 53498-53505
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-THG1L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for THG1L antibody (ARP47819)

Product page for THG1L antibody (ARP47819)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100656079 antibody; Loxodonta africana LOC100656079 antibody G3SV71 92%
Atlantic salmon thg1 antibody; Salmo salar thg1 antibody B5X5X1 91%
Bovine THG1 antibody; Bos taurus THG1 antibody Q05B50 92%
Chicken THG1L antibody; Gallus gallus THG1L antibody Q5ZIR4 85%
Common turkey THG1L antibody; Meleagris gallopavo THG1L antibody G1N0C5 85%
Dog THG1L antibody; Canis familiaris THG1L antibody E2RA61 92%
Duckbill platypus THG1L antibody; Ornithorhynchus anatinus THG1L antibody F6PG11 85%
Fruit fly DgriGH10821 antibody; Drosophila grimshawi DgriGH10821 antibody B4JAW6 83%
Fruit fly DvirGJ16007 antibody; Drosophila virilis DvirGJ16007 antibody B4LRY6 83%
Giant panda LOC100476440 antibody; Ailuropoda melanoleuca LOC100476440 antibody D2GUI2 92%
Gray short-tailed opossum LOC100025355 antibody; Monodelphis domestica LOC100025355 antibody F7F312 85%
Guinea pig THG1L antibody; Cavia porcellus THG1L antibody H0UY10 85%
Horse LOC100071194 antibody; Equus caballus LOC100071194 antibody F7AGP0 92%
Human THG1 antibody; Homo sapiens THG1 antibody Q9NWX6 100%
Human THG1L antibody; Homo sapiens THG1L antibody Q9H8R6 100%
Little brown bat THG1L antibody; Myotis lucifugus THG1L antibody G1PTF3 100%
Lowland gorilla THG1L antibody; Gorilla gorilla gorilla THG1L antibody G3RV42 100%
Lowland gorilla THG1L antibody; Gorilla gorilla gorilla THG1L antibody G3R000 100%
Northern pike THG1 antibody; Esox lucius THG1 antibody C1BYC0 91%
Northern white-cheeked gibbon LOC100602201 antibody; Nomascus leucogenys LOC100602201 antibody G1QVS4 100%
Rabbit LOC100353509 antibody; Oryctolagus cuniculus LOC100353509 antibody G1SEM7 100%
Rhesus macaque THG1L antibody; Macaca mulatta THG1L antibody F7GJ21 100%
Sablefish THG1 antibody; Anoplopoma fimbria THG1 antibody C3KH72 91%
salmon louse THG1 antibody; Lepeophtheirus salmonis THG1 antibody C1BTC6 78%
salmon louse THG1 antibody; Lepeophtheirus salmonis THG1 antibody C1BSF8 78%
Small-eared galago THG1L antibody; Otolemur garnettii THG1L antibody H0WZT3 85%
Tasmanian devil THG1L antibody; Sarcophilus harrisii THG1L antibody G3WWW9 92%
Three-spined stickleback THG1L antibody; Gasterosteus aculeatus THG1L antibody G3Q3D5 91%
Western clawed frog thg1l antibody; Xenopus tropicalis thg1l antibody F6VSZ7 78%
White-tufted-ear marmoset LOC100392376 antibody; Callithrix jacchus LOC100392376 antibody F7IKJ6 100%
White-tufted-ear marmoset LOC100392376 antibody; Callithrix jacchus LOC100392376 antibody F7IIB0 100%
Zebra finch THG1L antibody; Taeniopygia guttata THG1L antibody H0YQS0 78%

Product Protocols: THG1L antibody tested with Human Fetal Spleen Tissue (ARP47819_P050)

Aviva Systems Biology is the original manufacturer of this THG1L antibody (ARP47819_P050)

Click here to view the THG1L antibody Western Blot Protocol

Product Datasheet Link: THG1L antibody (ARP47819_P050)

WB Suggested Anti-THG1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:


Description of Target: THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s THG1L antibody (ARP47819_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question