website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

THG1L antibody - middle region (ARP47819_P050)

Description of Target:
THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.
Gene Symbol:
THG1L
Official Gene Full Name:
TRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
NCBI Gene Id:
54974
Alias Symbols:
FLJ11601; FLJ20546; ICF45
Tissue Tool:
Find tissues and cell lines supported to express THG1L.
Protein Accession #:
NP_060342
Nucleotide Accession#:
NM_017872
Swissprot Id:
Q9NWX6
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Probable tRNA(His) guanylyltransferase
Protein Size (# AA):
298
Molecular Weight:
35kDa
Application:
WB
Partner Proteins:
CG10032, CG13339, CG14764, CG15706, CG2199, CG31140, CG32647, CG34168, CG4068, CG6933, CkIIalpha, Cp16, Ef1alpha48D, Khc, RpS7, lsn, noc
Immunogen:
The immunogen for anti-THG1L antibody: synthetic peptide directed towards the middle region of human THG1L
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
THG1L antibody - middle region (ARP47819_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 91%; Rat: 86%; Guinea pig: 86%; Yeast: 83%; Zebrafish: 83%; Mouse: 79%
Species Reactivity:
Human, Rabbit, Dog, Horse, Bovine, Pig, Rat, Guinea pig, Zebrafish, Yeast, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-THG1L antibody
- ARP47819_P050
Peptide Sequence:
Synthetic peptide located within the following region: DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY
Blocking Peptide:
For anti-THG1L antibody is Catalog # AAP47819 (Previous Catalog # AAPY02034)
Key Reference:
Guo,D., (2004) J. Biol. Chem. 279 (51), 53498-53505
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-THG1L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question