THEX1 Antibody - C-terminal region (ARP41158_T100)

Catalog No: ARP41158_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-THEX1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human THEX1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ERI1 (ARP41158_T100) antibody is Catalog # AAP41158 (Previous Catalog # AAPP22533)
• Reference: Cheng,Y. (2004) J. Mol. Biol. 343 (2), 305-312

Target Info

• Gene Symbol: ERI1
• Gene Full Name: Exoribonuclease 1
• Alias Symbols: HEXO, THEX1, 3'HEXO
• NCBI Gene Id: 90459
• Protein Name: 3'-5' exoribonuclease 1
• Description of Target: THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).
• Uniprot ID: Q8IV48
• Protein Accession #: NP_699163
• Nucleotide Accession #: NM_153332
• Protein Size (# AA): 349
• Molecular Weight: 38kDa
• Protein Interactions: UBC; HNRNPD; HHV8GK18_gp81; SLBP;