SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37156_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP37156_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-Tgfb1 (ARP37156_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Concentration0.5 mg/ml
Blocking PeptideFor anti-Tgfb1 (ARP37156_T100-FITC) antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Gene SymbolTgfb1
Gene Full NameTransforming growth factor, beta 1
Alias SymbolsTgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1
NCBI Gene Id21803
Protein NameTransforming growth factor beta-1
Description of TargetTgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Uniprot IDP01137
Protein Accession #NP_035707
Nucleotide Accession #NM_011577
Protein Size (# AA)390
Molecular Weight42kDa
Protein InteractionsHtra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
  1. What is the species homology for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    This target may also be called "Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1" in publications.

  5. What is the shipping cost for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TGFB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TGFB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TGFB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TGFB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TGFB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TGFB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Tgfb1 Antibody - middle region : FITC (ARP37156_T100-FITC)
Your Rating
We found other products you might like!