website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

Tgfb1 antibody - middle region (ARP37156_T100)

Description of Target:
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Gene Symbol:
Tgfb1
Official Gene Full Name:
Transforming growth factor, beta 1
NCBI Gene Id:
21803
Alias Symbols:
TGF-beta1; TGFbeta1; Tgfb; Tgfb-1
Tissue Tool:
Find tissues and cell lines supported to express Tgfb1.
Protein Accession #:
NP_035707
Nucleotide Accession#:
NM_011577
Swissprot Id:
P01137
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Transforming growth factor beta-1
Protein Size (# AA):
390
Molecular Weight:
42kDa
Application:
WB
Partner Proteins:
Mdm2, Myc, Bbc3, Ccng1, Ccng2, Cdkn1a, Cdkn1a, Cdkn1a, Cdkn1a, Cdkn2a, Mdm2, Mdm2, Mdm2, Nanog, Perp, Perp, Pmaip1, Prkaa2, Rbbp6, Sin3a, Topors, Trp53inp1, Trp53inp1, Trp63, Trp73, CSNK1E, Daxx, Ddb1, ING4, MAPK10, MAPK8, MAPK9, Mdm2, TOPORS, TP53BP1, TSC2, Ubc, Ube2n
Immunogen:
The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
Tgfb1 antibody - middle region (ARP37156_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Horse, Bovine, Dog, Pig, Rabbit, Rat, Goat, Guinea pig, Mouse, Human, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-Tgfb1 antibody
- ARP37156_T100
Peptide Sequence:
Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Blocking Peptide:
For anti-Tgfb1 antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-Tgfb1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question