website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Tgfb1 antibody - middle region (ARP37156_T100)

Scroll Horizontally to view all Images
Print Page
100 ul
In Stock

Conjugation Options

ARP37156_T100-FITC Conjugated

ARP37156_T100-HRP Conjugated

ARP37156_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Transforming growth factor, beta 1
Protein Name:
Transforming growth factor beta-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
TGF-beta1, TGFbeta1, Tgfb, Tgfb-1
Replacement Item:
This antibody may replace item sc-130348 from Santa Cruz Biotechnology.
Description of Target:
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Tgfb1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Tgfb1.
The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-Tgfb1 (ARP37156_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
Blocking Peptide:
For anti-Tgfb1 (ARP37156_T100) antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Datasheets / Downloads:
Printable datasheet for anti-Tgfb1 (ARP37156_T100) antibody

Product Protocols: Tgfb1 antibody tested with Human Mouse Lymphnode Tissue (ARP37156_T100)

Aviva Systems Biology is the original manufacturer of this Tgfb1 antibody (ARP37156_T100)

Click here to view the Tgfb1 antibody Western Blot Protocol

Product Datasheet Link: Tgfb1 antibody (ARP37156_T100)

WB Suggested Anti-Tgfb1 Antibody Titration: 1.25ug/ml
Positive Control: Mouse Lymphnode

Western Blot image:

Description of Target: Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Tgfb1 antibody (ARP37156_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question