website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

Tgfb1 antibody - middle region (ARP37156_T100)

Description of Target:
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Gene Symbol:
Tgfb1
Official Gene Full Name:
Transforming growth factor, beta 1
NCBI Gene Id:
21803
Alias Symbols:
TGF-beta1; TGFbeta1; Tgfb; Tgfb-1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Tgfb1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Tgfb1.
Swissprot Id:
P01137
Protein Accession #:
NP_035707
Nucleotide Accession #:
NM_011577
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Transforming growth factor beta-1
Protein Size (# AA):
390
Molecular Weight:
42kDa
Application:
WB
Protein Interactions:
Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
Anti-Tgfb1 (ARP37156_T100)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Species Reactivity:
Cow; Dog; Goat; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-Tgfb1 (ARP37156_T100) antibody
Peptide Sequence:
Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Blocking Peptide:
For anti-Tgfb1 (ARP37156_T100) antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: Tgfb1 antibody tested with Human Mouse Lymphnode Tissue (ARP37156_T100)

Aviva Systems Biology is the original manufacturer of this Tgfb1 antibody (ARP37156_T100)

Click here to view the Tgfb1 antibody Western Blot Protocol

Product Datasheet Link: Tgfb1 antibody (ARP37156_T100)

WB Suggested Anti-Tgfb1 Antibody Titration: 1.25ug/ml
Positive Control: Mouse Lymphnode

Western Blot image:


Description of Target: Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s Tgfb1 antibody (ARP37156_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question