website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Tgfb1 antibody - middle region (ARP37156_T100)

Description of Target:
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Gene Symbol:
Official Gene Full Name:
Transforming growth factor, beta 1
NCBI Gene Id:
Alias Symbols:
TGF-beta1; TGFbeta1; Tgfb; Tgfb-1
Tissue Tool:
Find tissues and cell lines supported to express Tgfb1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transforming growth factor beta-1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Mdm2, Myc, Bbc3, Ccng1, Ccng2, Cdkn1a, Cdkn1a, Cdkn1a, Cdkn1a, Cdkn2a, Mdm2, Mdm2, Mdm2, Nanog, Perp, Perp, Pmaip1, Prkaa2, Rbbp6, Sin3a, Topors, Trp53inp1, Trp53inp1, Trp63, Trp73, CSNK1E, Daxx, Ddb1, ING4, MAPK10, MAPK8, MAPK9, Mdm2, TOPORS, TP53BP1, TSC2, Ubc, Ube2n
The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
Tgfb1 antibody - middle region (ARP37156_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Horse, Bovine, Dog, Pig, Rabbit, Rat, Goat, Guinea pig, Mouse, Human, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-Tgfb1 antibody
- ARP37156_T100
Peptide Sequence:
Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Blocking Peptide:
For anti-Tgfb1 antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for Tgfb1 antibody (ARP37156)

Product page for Tgfb1 antibody (ARP37156)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100667634 antibody; Loxodonta africana LOC100667634 antibody G3T0F7 100%
African elephant TGFB1 antibody; Loxodonta africana TGFB1 antibody G3TTG3 100%
Bovine TGFB1 antibody; Bos taurus TGFB1 antibody P18341 100%
Bovine TGFB1 antibody; Bos taurus TGFB1 antibody E1BNK3 100%
Dog Cfa.3509 antibody; Canis familiaris Cfa.3509 antibody F1PMQ2 100%
Dog Cfa.3509 antibody; Canis familiaris Cfa.3509 antibody F1PI70 100%
Dog TGFB1 antibody; Canis familiaris TGFB1 antibody P54831 100%
European domestic ferret TGFB1 antibody; Mustela putorius furo TGFB1 antibody Q38HS2 100%
Giant panda TGFB1 antibody; Ailuropoda melanoleuca TGFB1 antibody G1LYW1 100%
Goat TGF beta antibody; Capra hircus TGF beta antibody G9LQW0 100%
Gray short-tailed opossum TGFB1 antibody; Monodelphis domestica TGFB1 antibody F6PGT5 100%
Green monkey TGFB1 antibody; Chlorocebus aethiops TGFB1 antibody P09533 100%
Guinea pig TGFB1 antibody; Cavia porcellus TGFB1 antibody Q9Z1Y6 100%
Guinea pig TGFB1 antibody; Cavia porcellus TGFB1 antibody H0UVQ2 100%
Hispid cotton rat Tgfb1 antibody; Sigmodon hispidus Tgfb1 antibody Q8R4D9 85%
Horse TGFB1 antibody; Equus caballus TGFB1 antibody O19011 100%
Human TGFB1 antibody; Homo sapiens TGFB1 antibody P01137 100%
Human TGFB1 antibody; Homo sapiens TGFB1 antibody Q5PY19 100%
Little brown bat TGFB1 antibody; Myotis lucifugus TGFB1 antibody G1PM07 91%
Lowland gorilla TGFB1 antibody; Gorilla gorilla gorilla TGFB1 antibody G3SE85 100%
Lowland gorilla TGFB1 antibody; Gorilla gorilla gorilla TGFB1 antibody G3RKC0 100%
Mouse TGFB1 antibody; Mus musculus TGFB1 antibody P04202 100%
Mouse Tgfb1 antibody; Mus musculus Tgfb1 antibody Q3UNK5 100%
North American deer mouse Tgfb1 antibody; Peromyscus maniculatus Tgfb1 antibody Q6SLH0 100%
Northern white-cheeked gibbon TGFB1 antibody; Nomascus leucogenys TGFB1 antibody G1RTT5 100%
Pig TGFB1 antibody; Sus scrofa TGFB1 antibody P07200 100%
Rabbit TGFB1 antibody; Oryctolagus cuniculus TGFB1 antibody G1TC56 100%
Rat TGFB1 antibody; Rattus norvegicus TGFB1 antibody P17246 92%
Rhesus macaque TGFB1 antibody; Macaca mulatta TGFB1 antibody F7HGE6 100%
Rhesus macaque TGFB1 antibody; Macaca mulatta TGFB1 antibody F7HCV5 100%
Sheep TGFB1 antibody; Ovis aries TGFB1 antibody P50414 100%
Short-tailed field vole Tgfb1 antibody; Microtus agrestis Tgfb1 antibody F6K637 92%
Small-eared galago TGFB1 antibody; Otolemur garnettii TGFB1 antibody H0XU04 75%
White-tufted-ear marmoset TGFB1 antibody; Callithrix jacchus TGFB1 antibody F7BHY6 100%
White-tufted-ear marmoset TGFB1 antibody; Callithrix jacchus TGFB1 antibody F7BH97 100%
White-tufted-ear marmoset TGFB1 antibody; Callithrix jacchus TGFB1 antibody F6YSG5 100%
Woodchuck TGF-beta 1 antibody; Marmota monax TGF-beta 1 antibody E5LDB9 100%

Product Protocols: Tgfb1 antibody tested with Human Mouse Lymphnode Tissue (ARP37156_T100)

Aviva Systems Biology is the original manufacturer of this Tgfb1 antibody (ARP37156_T100)

Click here to view the Tgfb1 antibody Western Blot Protocol

Product Datasheet Link: Tgfb1 antibody (ARP37156_T100)

WB Suggested Anti-Tgfb1 Antibody Titration: 1.25ug/ml
Positive Control: Mouse Lymphnode

Western Blot image:

Description of Target: Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Tgfb1 antibody (ARP37156_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question