SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31400_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP31400_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-TFAM (ARP31400_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 83%; Guinea Pig: 75%; Horse: 92%; Human: 100%; Mouse: 75%; Pig: 92%; Rabbit: 83%
Peptide SequenceSynthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TFAM (ARP31400_P050-FITC) antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
ReferenceCruzen,M.E., Gene 362, 125-132 (2005)
Publications

Shi, X. et al. Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells. J. Biol. Chem. 283, 30658-67 (2008). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 18779333

Walters, M. W., Bjork, J. A. & Wallace, K. B. Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats. Toxicology 264, 10-5 (2009). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 19616056

Miyazaki, T. et al. Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption. J. Biol. Chem. 287, 37808-23 (2012). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 22988253

Kemper, M. F., Zhao, Y., Duckles, S. P. & Krause, D. N. Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms. J. Cereb. Blood Flow Metab. 33, 122-8 (2013). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 23093066

Lu, W. et al. ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction. Cell Death Dis. 3, e422 (2012). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 23152058

Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637-46 (2013). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24041461

Kemper, M. F., Stirone, C., Krause, D. N., Duckles, S. P. & Procaccio, V. Genomic and non-genomic regulation of PGC1 isoforms by estrogen to increase cerebral vascular mitochondrial biogenesis and reactive oxygen species protection. Eur. J. Pharmacol. 723, 322-9 (2014). IHC, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24275351

Vettor, R. et al. Exercise training boosts eNOS-dependent mitochondrial biogenesis in mouse heart: role in adaptation of glucose metabolism. Am. J. Physiol. Endocrinol. Metab. 306, E519-28 (2014). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24381004

Gene SymbolTFAM
Gene Full NameTranscription factor A, mitochondrial
Alias SymbolsTCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
NCBI Gene Id7019
Protein NameTranscription factor A, mitochondrial
Description of TargetThe function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Uniprot IDQ00059
Protein Accession #NP_003192
Nucleotide Accession #NM_003201
Protein Size (# AA)246
Molecular Weight29kDa
Protein InteractionsAGTRAP; FBXW11; ARL6IP1; NEDD1; PPP2R1A; GRSF1; UBC; MDM2; SUZ12; EED; PAN2; MYC; FN1; C1QBP; CAND1; COPS5; CUL3; ELAVL1; ICT1; TFB2M; TFB1M; PNP; NRF1;
  1. What is the species homology for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    This target may also be called "TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15" in publications.

  5. What is the shipping cost for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFAM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFAM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFAM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFAM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFAM Antibody - N-terminal region : FITC (ARP31400_P050-FITC)
Your Rating
We found other products you might like!