website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TFAM antibody - N-terminal region (ARP31400_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $145.00

In Stock

Conjugation Options

ARP31400_P050-FITC Conjugated

ARP31400_P050-HRP Conjugated

ARP31400_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Transcription factor A, mitochondrial
Protein Name:
Transcription factor A, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
TCF6, MtTF1, mtTFA, TCF6L1, TCF6L2, TCF6L3
Replacement Item:
This antibody may replace item sc-166965 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TFAM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TFAM.
The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 83%; Guinea Pig: 75%; Horse: 92%; Human: 100%; Mouse: 75%; Pig: 92%; Rabbit: 83%
Complete computational species homology data:
Anti-TFAM (ARP31400_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TFAM (ARP31400_P050) antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
Datasheets / Downloads:
Printable datasheet for anti-TFAM (ARP31400_P050) antibody
Target Reference:
Cruzen,M.E., Gene 362, 125-132 (2005)

Shi, X. et al. Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells. J. Biol. Chem. 283, 30658-67 (2008). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 18779333

Walters, M. W., Bjork, J. A. & Wallace, K. B. Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats. Toxicology 264, 10-5 (2009). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 19616056

Miyazaki, T. et al. Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption. J. Biol. Chem. 287, 37808-23 (2012). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 22988253

Kemper, M. F., Zhao, Y., Duckles, S. P. & Krause, D. N. Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms. J. Cereb. Blood Flow Metab. 33, 122-8 (2013). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 23093066

Lu, W. et al. ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction. Cell Death Dis. 3, e422 (2012). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 23152058

Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637-46 (2013). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24041461

Kemper, M. F., Stirone, C., Krause, D. N., Duckles, S. P. & Procaccio, V. Genomic and non-genomic regulation of PGC1 isoforms by estrogen to increase cerebral vascular mitochondrial biogenesis and reactive oxygen species protection. Eur. J. Pharmacol. 723, 322-9 (2014). IHC, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24275351

Vettor, R. et al. Exercise training boosts eNOS-dependent mitochondrial biogenesis in mouse heart: role in adaptation of glucose metabolism. Am. J. Physiol. Endocrinol. Metab. 306, E519-28 (2014). WB, Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse 24381004

Customer Reviews for TFAM Antibody (ARP31400_P050) tested with bEND3 cell lysate in Western blot

CAT# ARP31400_P050

TFAM antibody

TFAM antibody Western Blot

TFAM antibody bEnd.3 cell line

submitted by:
Martin Kemper
University of California Irvine

Product Protocols: TFAM antibody tested with Human Jurkat Cells (ARP31400_P050)

Aviva Systems Biology is the original manufacturer of this TFAM antibody (ARP31400_P050)

Click here to view the TFAM antibody Western Blot Protocol

Product Datasheet Link: TFAM antibody (ARP31400_P050)

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:

Description of Target: The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TFAM antibody (ARP31400_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: TFAM antibody-N-terminal region (ARP31400_P050) in HepG2, Hep3B and K562 cells using Western Blot

Product Page for TFAM antibody-N-terminal region (ARP31400_P050)

Application: Western blotting
Species+tissue/cell type: HepG2, Hep3B and K562 cells
How many ug’s of tissue/cell lysate run on the gel:
1: HepG2 cell lysate
2: HepG2 cell lysate
3: Hep3B cell lysate
4: Hep3B cell lysate
5: K562 cell lysate
6: K562 cell lysate
Primary antibody dilution: 1:1000
Secondary antibody:
Secondary antibody dilution: 1:1000


1. How do Aviva’s reagents play a role in your experimental goals?
--Used it for WESTERN BLOT.

2. How many different experimental trials were conducted using the antibody sample?

3. What type of experimental sample are you using and how did you prepare it?
-- Total Cell Lysates prepared by sonication in MSB buffer (Mannitol, Sucrose Buffer) .

4. What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.
-- Used it for WESTERN BLOT. Dilution for primary antibody (TFAM 1ug/ml) and for secondary antibody 1:1000.

5. What controls were used in your experiment? Please include your positive control.
-- No positive control.

6. For IHC, what antigen retrieval method did you use?
-- NA—

7. How did you store the antibody after re-suspension?
-- @ -20 degree Celsius

8. Please provide the protocol for your application procedure. Please be as detailed as possible.
-- Standard SDS-PAGE protocol is used to run the protein samples.
-- Blocking is done in 10% non-fat dry milk
-- Primary antibody was made in 5% BSA and incubated overnight
-- HRP-conjugated secondary antibody is also diluted in 5% BSA and incubated for 1hr
-- ECL substrate is used to develop and film exposure time is 10 sec.

10. How would you rate this antibody on a scale from 1-5? Why?
Very Good (Scale 1). It gave single band with no background at expected size.

11. Would you use this antibody in future experiments?

12. Please explain any problems you had with the antibody and/or experimental results that Aviva can address in the future.
TFAM antibody is OK.

13. Have you used another antibody which has worked in your application?

14. Do you believe the information about the reagent on Aviva’s website is correct?

15. If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?
We will be using it in future experiments.


Ask a Question