website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TFAM antibody - N-terminal region (ARP31400_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Gene Symbol:
Official Gene Full Name:
Transcription factor A, mitochondrial
NCBI Gene Id:
Alias Symbols:
TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3
Tissue Tool:
Find tissues and cell lines supported to express TFAM.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transcription factor A, mitochondrial
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TFAM antibody - N-terminal region (ARP31400_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Horse: 92%; Bovine: 92%; Dog: 83%; Rabbit: 83%; Mouse: 75%; Guinea pig: 75%
Species Reactivity:
Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TFAM antibody
- ARP31400_P050
Peptide Sequence:
Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
Blocking Peptide:
For anti-TFAM antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
Target Reference:
Cruzen,M.E., Gene 362, 125-132 (2005)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TFAM antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Anti-TFAM ARP31400_P050 has recently been referenced in the following publications:

Shi, X. et al. Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells. J. Biol. Chem. 283, 30658–67 (2008). 18779333

Walters, M. W., Bjork, J. A. & Wallace, K. B. Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats. Toxicology 264, 10–5 (2009). 19616056

Walters, M. W. & Wallace, K. B. Urea cycle gene expression is suppressed by PFOA treatment in rats. Toxicol. Lett. 197, 46–50 (2010). 20452409

Miyazaki, T. et al. Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption. J. Biol. Chem. 287, 37808–23 (2012). 22988253

Kemper, M. F., Zhao, Y., Duckles, S. P. & Krause, D. N. Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms. J. Cereb. Blood Flow Metab. 33, 122–8 (2013). 23093066

Lu, W. et al. ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction. Cell Death Dis. 3, e422 (2012). 23152058

Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637–46 (2013). 24041461

Customer Reviews for TFAM Antibody (ARP31400_P050) tested with bEND3 cell lysate in Western blot

CAT# ARP31400_P050

TFAM antibody

TFAM antibody Western Blot

TFAM antibody bEnd.3 cell line

submitted by:
Martin Kemper
University of California Irvine

Computational species homology for TFAM antibody (ARP31400)

Product page for TFAM antibody (ARP31400)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant TFAM antibody; Loxodonta africana TFAM antibody G3TAA7 75%
Bornean orangutan tfam antibody; Pongo pygmaeus tfam antibody Q4H0P8 100%
Bovine Bt.102328 antibody; Bos taurus Bt.102328 antibody F1MV25 91%
Bovine Bt.102328 antibody; Bos taurus Bt.102328 antibody E1BKV1 91%
Bovine BT.102328 antibody; Bos taurus BT.102328 antibody E1BA21 91%
Bovine TFAM antibody; Bos taurus TFAM antibody Q0II87 91%
Chimpanzee TFAM antibody; Pan troglodytes TFAM antibody Q4H0P9 100%
Chimpanzee tfam antibody; Pan troglodytes tfam antibody Q4GZG8 100%
Common gibbon tfam antibody; Hylobates lar tfam antibody Q4H0P7 83%
Dog TFAM antibody; Canis familiaris TFAM antibody E2RQ27 83%
Dog TFAM antibody; Canis familiaris TFAM antibody E2RJ35 83%
Giant panda LOC100479452 antibody; Ailuropoda melanoleuca LOC100479452 antibody D2I218 91%
Guinea pig TFAM antibody; Cavia porcellus TFAM antibody H0UT89 75%
Horse TFAM antibody; Equus caballus TFAM antibody F6YUX4 91%
Human TFAM antibody; Homo sapiens TFAM antibody Q00059 100%
Human TFAM antibody; Homo sapiens TFAM antibody Q6LES8 100%
Human TFAM antibody; Homo sapiens TFAM antibody E5KSU5 100%
Human TFAM antibody; Homo sapiens TFAM antibody A8MRB2 100%
Human TFAM antibody; Homo sapiens TFAM antibody Q05D31 100%
Human TFAM antibody; Homo sapiens TFAM antibody Q3SX57 91%
Little brown bat TFAM antibody; Myotis lucifugus TFAM antibody G1P5H6 83%
Lowland gorilla TFAM antibody; Gorilla gorilla gorilla TFAM antibody G3QQI3 100%
Mouse Tfam antibody; Mus musculus Tfam antibody Q3TSW9 75%
Northern white-cheeked gibbon TFAM antibody; Nomascus leucogenys TFAM antibody G1RNX3 100%
Olive baboon tfam antibody; Papio anubis tfam antibody Q4H0P6 100%
Pig TFAM antibody; Sus scrofa TFAM antibody Q5D144 91%
Pig Tfam antibody; Sus scrofa Tfam antibody Q9GL64 91%
Pygmy chimpanzee tfam antibody; Pan paniscus tfam antibody Q4H0Q0 100%
Pygmy chimpanzee tfam antibody; Pan paniscus tfam antibody Q4GZG9 100%
Rabbit TFAM antibody; Oryctolagus cuniculus TFAM antibody G1T7C0 83%
Rhesus macaque TFAM antibody; Macaca mulatta TFAM antibody F7FXP0 91%
Silvered leaf-monkey TFAM antibody; Trachypithecus cristatus TFAM antibody Q4H0T5 100%
Small-eared galago TFAM antibody; Otolemur garnettii TFAM antibody H0XC91 83%
Sumatran orangutan TFAM antibody; Pongo abelii TFAM antibody Q5REW5 100%
Tasmanian devil TFAM antibody; Sarcophilus harrisii TFAM antibody G3WAP6 83%
White-tufted-ear marmoset LOC100385496 antibody; Callithrix jacchus LOC100385496 antibody F6QBQ9 78%

Product Protocols: TFAM antibody tested with Human Jurkat Cells (ARP31400_P050)

Aviva Systems Biology is the original manufacturer of this TFAM antibody (ARP31400_P050)

Click here to view the TFAM antibody Western Blot Protocol

Product Datasheet Link: TFAM antibody (ARP31400_P050)

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:

Description of Target: The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TFAM antibody (ARP31400_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: TFAM antibody-N-terminal region (ARP31400_P050) in HepG2, Hep3B and K562 cells using Western Blot

Product Page for TFAM antibody-N-terminal region (ARP31400_P050)

Application: Western blotting
Species+tissue/cell type: HepG2, Hep3B and K562 cells
How many ug’s of tissue/cell lysate run on the gel:
1: HepG2 cell lysate
2: HepG2 cell lysate
3: Hep3B cell lysate
4: Hep3B cell lysate
5: K562 cell lysate
6: K562 cell lysate
Primary antibody dilution: 1:1000
Secondary antibody:
Secondary antibody dilution: 1:1000


1. How do Aviva’s reagents play a role in your experimental goals?
--Used it for WESTERN BLOT.

2. How many different experimental trials were conducted using the antibody sample?

3. What type of experimental sample are you using and how did you prepare it?
-- Total Cell Lysates prepared by sonication in MSB buffer (Mannitol, Sucrose Buffer) .

4. What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.
-- Used it for WESTERN BLOT. Dilution for primary antibody (TFAM 1ug/ml) and for secondary antibody 1:1000.

5. What controls were used in your experiment? Please include your positive control.
-- No positive control.

6. For IHC, what antigen retrieval method did you use?
-- NA—

7. How did you store the antibody after re-suspension?
-- @ -20 degree Celsius

8. Please provide the protocol for your application procedure. Please be as detailed as possible.
-- Standard SDS-PAGE protocol is used to run the protein samples.
-- Blocking is done in 10% non-fat dry milk
-- Primary antibody was made in 5% BSA and incubated overnight
-- HRP-conjugated secondary antibody is also diluted in 5% BSA and incubated for 1hr
-- ECL substrate is used to develop and film exposure time is 10 sec.

10. How would you rate this antibody on a scale from 1-5? Why?
Very Good (Scale 1). It gave single band with no background at expected size.

11. Would you use this antibody in future experiments?

12. Please explain any problems you had with the antibody and/or experimental results that Aviva can address in the future.
TFAM antibody is OK.

13. Have you used another antibody which has worked in your application?

14. Do you believe the information about the reagent on Aviva’s website is correct?

15. If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?
We will be using it in future experiments.


Ask a Question