website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TFAM antibody - N-terminal region (ARP31400_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Publications:

Anti-TFAM ARP31400_P050 has recently been referenced in the following publications:

Shi, X. et al. Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells. J. Biol. Chem. 283, 30658–67 (2008). , 18779333

Walters, M. W., Bjork, J. A. & Wallace, K. B. Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats. Toxicology 264, 10–5 (2009). , 19616056

Walters, M. W. & Wallace, K. B. Urea cycle gene expression is suppressed by PFOA treatment in rats. Toxicol. Lett. 197, 46–50 (2010). , 20452409

Miyazaki, T. et al. Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption. J. Biol. Chem. 287, 37808–23 (2012). , 22988253

Kemper, M. F., Zhao, Y., Duckles, S. P. & Krause, D. N. Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms. J. Cereb. Blood Flow Metab. 33, 122–8 (2013). , 23093066

Lu, W. et al. ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction. Cell Death Dis. 3, e422 (2012). , 23152058

Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637–46 (2013). , 24041461

Description of Target:
The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Gene Symbol:
TFAM
Official Gene Full Name:
Transcription factor A, mitochondrial
NCBI Gene Id:
7019
Alias Symbols:
TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3
Tissue Tool:
Find tissues and cell lines supported to express TFAM.
Protein Accession #:
NP_003192
Nucleotide Accession#:
NM_003201
Swissprot Id:
Q00059
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Transcription factor A, mitochondrial
Protein Size (# AA):
246
Molecular Weight:
29kDa
Application:
WB
Partner Proteins:
MAX, MYC, SIN3A, SIN3B, SMC3, MAX, SMC3
Immunogen:
The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TFAM antibody - N-terminal region (ARP31400_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Horse: 92%; Bovine: 92%; Dog: 83%; Rabbit: 83%; Mouse: 75%; Guinea pig: 75%
Species Reactivity:
Human, Bovine, Horse, Pig, Dog, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TFAM antibody
- ARP31400_P050
Peptide Sequence:
Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
Blocking Peptide:
For anti-TFAM antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
Key Reference:
Cruzen,M.E., Gene 362, 125-132 (2005)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TFAM antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question