TDRD9 Antibody - C-terminal region (ARP36531_P050)

Catalog No: ARP36531_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: TDRD9
Sample Type: ACHN Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 89%
• Peptide Sequence: Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TDRD9 (ARP36531_P050) antibody is Catalog # AAP36531

Target Info

• Gene Symbol: TDRD9
• Gene Full Name: tudor domain containing 9
• Alias Symbols: HLS, SPNE, HIG-1, NET54, SPGF30, C14orf75
• NCBI Gene Id: 122402
• Protein Name: Putative ATP-dependent RNA helicase TDRD9
• Description of Target: TDRD9 is a probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. TDRD9 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process.
• Uniprot ID: Q8NDG6
• Protein Accession #: NP_694591
• Nucleotide Accession #: NM_153046
• Protein Size (# AA): 1382
• Molecular Weight: 152kDa
• Protein Interactions: PPP2R1A; UBC;