TBPL1 Antibody - middle region (ARP35751_T100)

Catalog No: ARP35751_T100

WB Suggested Anti-TBPL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBPL1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TBPL1 (ARP35751_T100) antibody is Catalog # AAP35751 (Previous Catalog # AAPP07003)
• Reference: Martianov,I., et al., (2002) Development 129 (4), 945-955

Target Info

• Gene Symbol: TBPL1
• Gene Full Name: TBP-like 1
• Alias Symbols: TLF, TLP, STUD, TRF2, MGC:8389, MGC:9620
• NCBI Gene Id: 9519
• Protein Name: TATA box-binding protein-like protein 1
• Description of Target: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TBPL1 encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.
• Uniprot ID: P62380
• Protein Accession #: NP_004856
• Nucleotide Accession #: NM_004865
• Protein Size (# AA): 186
• Molecular Weight: 21kDa
• Protein Interactions: TNNT1; FUS; APP; PRNP; ELAVL1; UBC; TERF2; TERF1; TBPL2; TAF1L; TBP; TAF6; TAF5; TAF4; TAF1; HSPA9; GTF2A2; GTF2A1; SLC35F6; ABCF3; NDUFA6; GTF2B; PTCD3; IRAK4; RAB35; PLIN3; RPL10; NF1; PMVK;