website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TBCB antibody - C-terminal region (ARP51934_P050)

Description of Target:
TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.
Gene Symbol:
Official Gene Full Name:
Tubulin folding cofactor B
NCBI Gene Id:
Alias Symbols:
CG22; CKAP1; CKAPI; MGC14625
Sample Type Confirmation:

TBCB is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Tissue Tool:
Find tissues and cell lines supported to express TBCB.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tubulin-folding cofactor B
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
AP3D1, AP3B2, AP3D1, AP3S2, IRS1, SCARB2, SLC30A3, IRS1
The immunogen for anti-TBCB antibody: synthetic peptide directed towards the C terminal of human TBCB
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TBCB antibody - C-terminal region (ARP51934_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Dog, Horse, Rabbit, Rat, Guinea pig, Bovine, Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TBCB antibody
- ARP51934_P050
Peptide Sequence:
Synthetic peptide located within the following region: YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Blocking Peptide:
For anti-TBCB antibody is Catalog # AAP51934 (Previous Catalog # AAPY03590)
Key Reference:
Rayala,S.K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (49), 19470-19475
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TBCB antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question