website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TBCB antibody - C-terminal region (ARP51934_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP51934_P050-FITC Conjugated

ARP51934_P050-HRP Conjugated

ARP51934_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Tubulin folding cofactor B
Protein Name:
Tubulin-folding cofactor B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CG22, CKAP1, CKAPI, MGC14625
Replacement Item:
This antibody may replace item sc-366842 from Santa Cruz Biotechnology.
Description of Target:
TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBCB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBCB.
The immunogen is a synthetic peptide directed towards the C terminal region of human TBCB
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TBCB (ARP51934_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TBCB (ARP51934_P050) antibody is Catalog # AAP51934 (Previous Catalog # AAPY03590)
Datasheets / Downloads:
Printable datasheet for anti-TBCB (ARP51934_P050) antibody
Sample Type Confirmation:

TBCB is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Rayala,S.K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (49), 19470-19475

Product Review: TBCB antibody - C-terminal region (ARP51934_P050) tested with HEK293T cells in Western blot

Product Page Link: TBCB antibody - C-terminal region (ARP51934_P050)

Data submitted by: Dr. Victor Lundin, Stanford University.

"The TBCB antibody ARP51934_P050 works well for us in western blots (see western blot results attached). In HEK293T cell lysate, we can detect transfected Flag-tagged TBCB with similar sensitivity as with a monoclonal Flag antibody. In addition, we can detect endogenous TBCB in untransfected HEK293T cell lysate."

Customer Reviews for TBCB Antibody (ARP51934_P050) tested with HEK293T cells in Western blot


TBCB antibody
TBCB antibody Western Blot

TBCB antibody HEK293 cells

"The TBCB antibody ARP51934_P050 works well for us in western blots"

Product Protocols: TBCB antibody tested with Human Fetal Lung Tissue (ARP51934_P050)

Aviva Systems Biology is the original manufacturer of this TBCB antibody (ARP51934_P050)

Click here to view the TBCB antibody Western Blot Protocol

Product Datasheet Link: TBCB antibody (ARP51934_P050)

WB Suggested Anti-TBCB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Lung

Western Blot image:

Description of Target: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TBCB antibody (ARP51934_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question