website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TBCB antibody - C-terminal region (ARP51934_P050)

Description of Target:
TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.
Gene Symbol:
Official Gene Full Name:
Tubulin folding cofactor B
NCBI Gene Id:
Alias Symbols:
CG22; CKAP1; CKAPI; MGC14625
Sample Type Confirmation:

TBCB is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Tissue Tool:
Find tissues and cell lines supported to express TBCB.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tubulin-folding cofactor B
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TBCB antibody: synthetic peptide directed towards the C terminal of human TBCB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
TBCB antibody - C-terminal region (ARP51934_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Dog, Horse, Rabbit, Rat, Guinea pig, Bovine, Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TBCB antibody
- ARP51934_P050
Peptide Sequence:
Synthetic peptide located within the following region: YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Blocking Peptide:
For anti-TBCB antibody is Catalog # AAP51934 (Previous Catalog # AAPY03590)
Target Reference:
Rayala,S.K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (49), 19470-19475
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Review: TBCB antibody - C-terminal region (ARP51934_P050) tested with HEK293T cells in Western blot

Product Page Link: TBCB antibody - C-terminal region (ARP51934_P050)

Data submitted by: Dr. Victor Lundin, Stanford University.

"The TBCB antibody ARP51934_P050 works well for us in western blots (see western blot results attached). In HEK293T cell lysate, we can detect transfected Flag-tagged TBCB with similar sensitivity as with a monoclonal Flag antibody. In addition, we can detect endogenous TBCB in untransfected HEK293T cell lysate."

Customer Reviews for TBCB Antibody (ARP51934_P050) tested with HEK293T cells in Western blot


TBCB antibody
TBCB antibody Western Blot

TBCB antibody HEK293 cells

"The TBCB antibody ARP51934_P050 works well for us in western blots"

Computational species homology for TBCB antibody (ARP51934)

Product page for TBCB antibody (ARP51934)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog MGC81145 antibody; Xenopus laevis MGC81145 antibody Q6NU87 84%
African clawed frog tbcb antibody; Xenopus laevis tbcb antibody Q3KPK1 84%
African elephant LOC100657878 antibody; Loxodonta africana LOC100657878 antibody G3UFX9 91%
Atlantic salmon tbcb antibody; Salmo salar tbcb antibody B5X4J7 100%
Bovine TBCB antibody; Bos taurus TBCB antibody Q5E951 100%
Channel catfish tbcb antibody; Ictalurus punctatus tbcb antibody E3TE39 100%
Dog TBCB antibody; Canis familiaris TBCB antibody E2QYN0 100%
Fruit fly DperGL11533 antibody; Drosophila persimilis DperGL11533 antibody B4GBE4 78%
Fruit fly DpseGA10860 antibody; Drosophila pseudoobscura pseudoobscura DpseGA10860 antibody Q290Q2 78%
Gray short-tailed opossum TBCB antibody; Monodelphis domestica TBCB antibody F6U7B4 92%
Guinea pig LOC100727483 antibody; Cavia porcellus LOC100727483 antibody H0VKN9 100%
Horse TBCB antibody; Equus caballus TBCB antibody F6UNW8 100%
Human TBCB antibody; Homo sapiens TBCB antibody Q99426 100%
Human TBCB antibody; Homo sapiens TBCB antibody Q6FGY5 100%
Little brown bat TBCB antibody; Myotis lucifugus TBCB antibody G1PKA6 100%
Lowland gorilla TBCB antibody; Gorilla gorilla gorilla TBCB antibody G3RHC3 100%
Mouse TBCB antibody; Mus musculus TBCB antibody Q9D1E6 100%
Northern white-cheeked gibbon TBCB antibody; Nomascus leucogenys TBCB antibody G1RLX2 100%
Pig TBCB antibody; Sus scrofa TBCB antibody Q8HXL4 100%
Rabbit LOC100349455 antibody; Oryctolagus cuniculus LOC100349455 antibody G1TAM3 100%
Rat Tbcb antibody; Rattus norvegicus Tbcb antibody Q1W1V7 100%
Rat Tbcb antibody; Rattus norvegicus Tbcb antibody Q1RP74 100%
Red flour beetle LOC656740 antibody; Tribolium castaneum LOC656740 antibody D6WA48 83%
Rhesus macaque CKAP1 antibody; Macaca mulatta CKAP1 antibody F7A412 100%
Small-eared galago TBCB antibody; Otolemur garnettii TBCB antibody H0X4Y6 100%
Three-spined stickleback TBCB antibody; Gasterosteus aculeatus TBCB antibody G3P5E2 85%
Three-spined stickleback TBCB antibody; Gasterosteus aculeatus TBCB antibody G3P5D0 85%
Western clawed frog tbcb antibody; Xenopus tropicalis tbcb antibody F7BMV7 84%
White-tufted-ear marmoset LOC100396025 antibody; Callithrix jacchus LOC100396025 antibody F7IEI4 100%
Zebrafish DKEY-3B8.1 antibody; Danio rerio DKEY-3B8.1 antibody A8DZJ0 100%
Zebrafish tbcb antibody; Danio rerio tbcb antibody Q803K6 100%
Zebrafish tbcb antibody; Danio rerio tbcb antibody A8E5P1 100%

Product Protocols: TBCB antibody tested with Human Fetal Lung Tissue (ARP51934_P050)

Aviva Systems Biology is the original manufacturer of this TBCB antibody (ARP51934_P050)

Click here to view the TBCB antibody Western Blot Protocol

Product Datasheet Link: TBCB antibody (ARP51934_P050)

WB Suggested Anti-TBCB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Lung

Western Blot image:

Description of Target: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TBCB antibody (ARP51934_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question