SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100965_P050
Price: $0.00
SKU
P100965_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAF12 (P100965_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, CHIP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TAF12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF12 (P100965_P050) antibody is Catalog # AAP31326 (Previous Catalog # AAPP02076)
Sample Type Confirmation

TAF12 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit12
ReferenceDenissov,S., (2007) EMBO J. 26 (4), 944-954
Description
Gene SymbolTAF12
Gene Full NameTAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Alias SymbolsTAF2J, TAFII20
NCBI Gene Id6883
Protein NameTranscription initiation factor TFIID subunit 12
Description of TargetControl of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I.Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ16514
Protein Accession #NP_005635
Nucleotide Accession #NM_005644
Protein Size (# AA)161
Molecular Weight18kDa
Protein InteractionsPRKAR2B; SUMO1; UBE2I; TAF4B; KAT2B; HIST3H3; SUPT3H; TAF4; ERCC1; TAF10; ELAVL1; CPSF1; TAF3; TBP; TAF1A; TAF1C; ATF7; ATXN7; NFYC; NFYB; NFYA; TAF6; TAF8; TAF9; TAF11; TAF5; TAF15; TAF7; TAF2; TAF1; MYC;
  1. What is the species homology for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TAF12 Antibody - N-terminal region (P100965_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF12 Antibody - N-terminal region (P100965_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    This target may also be called "TAF2J, TAFII20" in publications.

  5. What is the shipping cost for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF12 Antibody - N-terminal region (P100965_P050)
Your Rating
We found other products you might like!