STK39 Antibody - C-terminal region (ARP48745_P050)

Catalog No: ARP48745_P050

WB Suggested Anti-STK39 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateSTK39 is supported by BioGPS gene expression data to be expressed in Jurkat

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STK39
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: CAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STK39 (ARP48745_P050) antibody is Catalog # AAP48745 (Previous Catalog # AAPY02592)
• Sample Type Confirmation:

  STK39 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Ramoz,N., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Target Info

• Gene Symbol: STK39
• Gene Full Name: Serine threonine kinase 39
• Alias Symbols: DCHT, PASK, SPAK
• NCBI Gene Id: 27347
• Protein Name: STE20/SPS1-related proline-alanine-rich protein kinase
• Description of Target: STK39 is a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9UEW8
• Protein Accession #: NP_037365
• Nucleotide Accession #: NM_013233
• Protein Size (# AA): 545
• Molecular Weight: 59kDa
• Protein Interactions: UBC; FKBP9; EHD1; NOL3; API5; XPNPEP1; PCNA; NUBP1; SPP1; RELT; SLC12A6; SLC12A2; WNK4; SLC12A1; PRKCQ; MAPK14; MBP; STK39; HSPH1; AATK; OTOF; GSN;