Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP39000_P050
Price: $0.00
SKU
ARP39000_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-STAT5B (ARP39000_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Prostate
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Testis, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Brain, cortex
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAT5B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP
Concentration0.5 mg/ml
Blocking PeptideFor anti-STAT5B (ARP39000_P050) antibody is Catalog # AAP39000 (Previous Catalog # AAPY02004)
Sample Type Confirmation

There is BioGPS gene expression data showing that STAT5B is expressed in HEK293T

ReferenceMohankumar,K.M., (2008) Endocrinology 149 (5), 2219-2229
Gene SymbolSTAT5B
Gene Full NameSignal transducer and activator of transcription 5B
Alias SymbolsSTAT5, GHISID2
NCBI Gene Id6777
Protein NameSignal transducer and activator of transcription 5B
Description of TargetThe protein is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP51692
Protein Accession #NP_036580
Nucleotide Accession #NM_012448
Protein Size (# AA)787
Molecular Weight90kDa
Protein InteractionsJAK2; KIT; SURF2; AARS; DPP9; NIF3L1; RPRD1B; ANKMY2; RPRD1A; TOM1L1; DMRTA1; AFTPH; SERTAD1; HAX1; TFG; VCAM1; UBC; INSR; IL15; APP; C18orf8; STAT5B; PRLR; PGR; FGFR2; POU2F1; ELP2; CENPJ; PPP2CA; STAP2; RARA; PTPN2; NMI; EP300; CRKL; STAT5A; GHR; NCOR2;
  1. What is the species homology for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAT5B Antibody - N-terminal region (ARP39000_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    This target may also be called "STAT5, GHISID2" in publications.

  5. What is the shipping cost for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "90kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAT5B Antibody - N-terminal region (ARP39000_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STAT5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAT5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAT5B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAT5B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAT5B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAT5B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAT5B Antibody - N-terminal region (ARP39000_P050)
Your Rating
We found other products you might like!