ST6GALNAC2 Antibody - middle region (ARP53653_P050)

Catalog No: ARP53653_P050

WB Suggested Anti-ST6GALNAC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ST6GALNAC2 (ARP53653_P050) antibody is Catalog # AAP53653 (Previous Catalog # AAPP30493)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Li,G.S., (2007) Hum. Mutat. 28 (10), 950-957

Target Info

• Gene Symbol: ST6GALNAC2
• Gene Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
• Alias Symbols: STHM, SIAT7, SAITL1, SIAT7B, SIATL1, ST6GalNAII
• NCBI Gene Id: 10610
• Protein Name: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
• Description of Target: ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-255 AC015802.21 33337-33591 256-1378 BT019972.1 1-1123 1379-2105 AC015802.21 53295-54021
• Uniprot ID: Q9UJ37
• Protein Accession #: NP_006447
• Nucleotide Accession #: NM_006456
• Protein Size (# AA): 374
• Molecular Weight: 42 kDa
• Protein Interactions: SMAD3;