website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SSX8 antibody - C-terminal region (ARP51719_P050)

  • Catalog#: ARP51719_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    SSX8
    NCBI Gene Id:
    280659
    Official Gene Full Name:
    Synovial sarcoma, X breakpoint 8
    Protein Name:
    Protein SSX8
    Swissprot Id:
    Q7RTT4
    Protein Accession #:
    NP_777621
    Nucleotide Accession #:
    NM_174961
    Alias Symbols:
    -
    Description of Target:
    SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.
    Protein Size (# AA):
    148
    Molecular Weight:
    17kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express SSX8.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express SSX8.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the C terminal region of human SSX8
    Species Reactivity:
    Human
    Predicted Homology Based on Immunogen Sequence:
    Human: 86%
    Complete computational species homology data:
    Anti-SSX8 (ARP51719_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-SSX8 (ARP51719_P050) antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537)
    Datasheets / Downloads:
    Printable datasheet for anti-SSX8 (ARP51719_P050) antibody

    Product Protocols: SSX8 antibody tested with Human Fetal Liver Tissue (ARP51719_P050)

    Aviva Systems Biology is the original manufacturer of this SSX8 antibody (ARP51719_P050)

    Click here to view the SSX8 antibody Western Blot Protocol

    Product Datasheet Link: SSX8 antibody (ARP51719_P050)

    WB Suggested Anti-SSX8 Antibody Titration: 0.2-1 ug/ml
    Positive Control: Fetal Liver

    Western Blot image:


    Description of Target: SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s SSX8 antibody (ARP51719_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question