website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

SSX8 antibody - C-terminal region (ARP51719_P050)

Description of Target:
SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.
Gene Symbol:
SSX8
Official Gene Full Name:
Synovial sarcoma, X breakpoint 8
NCBI Gene Id:
280659
Alias Symbols:
-
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SSX8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SSX8.
Swissprot Id:
Q7RTT4
Protein Accession #:
NP_777621
Nucleotide Accession #:
NM_174961
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Protein SSX8
Protein Size (# AA):
148
Molecular Weight:
17kDa
Application:
WB
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SSX8
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-SSX8 (ARP51719_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 86%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for anti-SSX8 (ARP51719_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF
Blocking Peptide:
For anti-SSX8 (ARP51719_P050) antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SSX8 antibody tested with Human Fetal Liver Tissue (ARP51719_P050)

Aviva Systems Biology is the original manufacturer of this SSX8 antibody (ARP51719_P050)

Click here to view the SSX8 antibody Western Blot Protocol

Product Datasheet Link: SSX8 antibody (ARP51719_P050)

WB Suggested Anti-SSX8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:


Description of Target: SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SSX8 antibody (ARP51719_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question