website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SSX8 antibody - C-terminal region (ARP51719_P050)

Description of Target:
SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.
Gene Symbol:
Official Gene Full Name:
Synovial sarcoma, X breakpoint 8
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express SSX8.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein SSX8
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-SSX8 antibody: synthetic peptide directed towards the C terminal of human SSX8
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
SSX8 antibody - C-terminal region (ARP51719_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 86%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-SSX8 antibody
- ARP51719_P050
Peptide Sequence:
Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF
Blocking Peptide:
For anti-SSX8 antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SSX8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question