website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SSX8 antibody - C-terminal region (ARP51719_P050)

Description of Target:
SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.
Gene Symbol:
Official Gene Full Name:
Synovial sarcoma, X breakpoint 8
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express SSX8.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein SSX8
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-SSX8 antibody: synthetic peptide directed towards the C terminal of human SSX8
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
SSX8 antibody - C-terminal region (ARP51719_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 86%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-SSX8 antibody
- ARP51719_P050
Peptide Sequence:
Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF
Blocking Peptide:
For anti-SSX8 antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SSX8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for SSX8 antibody (ARP51719)

Product page for SSX8 antibody (ARP51719)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human SSX11 antibody; Homo sapiens SSX11 antibody A6NNU9 85%

Product Protocols: SSX8 antibody tested with Human Fetal Liver Tissue (ARP51719_P050)

Aviva Systems Biology is the original manufacturer of this SSX8 antibody (ARP51719_P050)

Click here to view the SSX8 antibody Western Blot Protocol

Product Datasheet Link: SSX8 antibody (ARP51719_P050)

WB Suggested Anti-SSX8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: SSX8 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SSX8 antibody (ARP51719_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question