SORT1 Antibody - C-terminal region (ARP64630_P050)

Catalog No: ARP64630_P050

WB Suggested Anti-SORT1 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell

Rabbit Anti-SORT1 Antibody
Catalog Number: ARP64630_P050
Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue
Observed Staining: Cytoplasm and plasma membrane in cardiomyocytes
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SORT1 (ARP64630_P050) antibody is Catalog # AAP64630

Target Info

• Gene Symbol: SORT1
• Gene Full Name: Sortilin 1
• Alias Symbols: NT3, Gp95, NTR3, LDLCQ6
• NCBI Gene Id: 6272
• Protein Name: Sortilin
• Description of Target: This gene encodes a protein that is a multi-ligand type-1 receptor with similarity to the yeast carboxypeptidase Y sorting receptor Vps10 protein. The encoded protein, a trans-Golgi network (TGN) transmembrane protein, binds a number of unrelated ligands that participate in a wide range of cellular processes; however, it lacks the typical features of a signalling receptor. In the TGN, furin mediates the activation of the mature binding form. The encoded protein consists of a large luminal domain, a single transmembrane segment and short C-terminal cytoplasmic tail. The luminal domain contains a cysteine-rich region similar to two corresponding segments in the yeast Vps10p; the cytoplasmic tail is similar to the corresponding segment of the cation-independent mannose 6-phosphate receptor and the tail also interacts with the VHS domains of GGA (Golgi-associated, gamma-adaptin homologous, ARF-interacting) proteins.
• Uniprot ID: Q99523
• Protein Accession #: NP_002950
• Nucleotide Accession #: NM_002959
• Protein Size (# AA): 831
• Molecular Weight: 84kDa
• Protein Interactions: NUDCD3; UBC; SORCS1; GGA1; GGA3; GGA2; STAM; ELAVL1; NTS; NGF; NGFR; BDNF; LRPAP1; CDK2; SLC2A4;