- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SNRP70 Antibody - N-terminal region (ARP40275_P050)
Datasheets/Manuals | Printable datasheet for anti-SNRNP70 (ARP40275_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SNRP70 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SNRNP70 (ARP40275_P050) antibody is Catalog # AAP40275 (Previous Catalog # AAPP10312) |
Sample Type Confirmation | SNRNP70 is supported by BioGPS gene expression data to be expressed in Jurkat |
Reference | Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716 |
Publications | Wang, E. & Cambi, F. Heterogeneous nuclear ribonucleoproteins H and F regulate the proteolipid protein/DM20 ratio by recruiting U1 small nuclear ribonucleoprotein through a complex array of G runs. J. Biol. Chem. 284, 11194-204 (2009). 19244236 Wang, E., Mueller, W. F., Hertel, K. J. & Cambi, F. G Run-mediated recognition of proteolipid protein and DM20 5’ splice sites by U1 small nuclear RNA is regulated by context and proximity to the splice site. J. Biol. Chem. 286, 4059-71 (2011). 21127064 |
Gene Symbol | SNRNP70 |
---|---|
Gene Full Name | Small nuclear ribonucleoprotein 70kDa (U1) |
Alias Symbols | RPU1, Snp1, U1AP, U170K, U1RNP, RNPU1Z, SNRP70, U1-70K |
NCBI Gene Id | 6625 |
Protein Name | U1 small nuclear ribonucleoprotein 70 kDa |
Description of Target | SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Uniprot ID | P08621 |
Protein Accession # | NP_003080 |
Nucleotide Accession # | NM_003089 |
Protein Size (# AA) | 437 |
Molecular Weight | 52kDa |
Protein Interactions | IL32; UBC; NEDD8; LIN28A; EZH2; SUZ12; EED; RNF2; rev; WBP4; SRPK2; SRPK1; MYC; SRPK3; HDAC2; PAN2; SMURF2; PRPF40A; CDKL3; RNF11; PRKD2; SKIL; RELA; RASGRF1; SMAD9; SMAD5; SMAD4; SMAD3; SMAD2; CHERP; PRMT5; UBL4A; VCAM1; SMAD1; ITGA4; IL7R; IFIT3; IFIT1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SNRP70 Antibody - N-terminal region (ARP40275_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
This target may also be called "RPU1, Snp1, U1AP, U170K, U1RNP, RNPU1Z, SNRP70, U1-70K" in publications.
-
What is the shipping cost for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "52kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SNRP70 Antibody - N-terminal region (ARP40275_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SNRNP70"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SNRNP70"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SNRNP70"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SNRNP70"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SNRNP70"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SNRNP70"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.