website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SNCA antibody - middle region (ARP42350_P050)

Description of Target:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.
Gene Symbol:
SNCA
Official Gene Full Name:
Synuclein, alpha (non A4 component of amyloid precursor)
NCBI Gene Id:
6622
Alias Symbols:
MGC110988; NACP; PARK1; PARK4; PD1
Tissue Tool:
Find tissues and cell lines supported to express SNCA.
Protein Accession #:
NP_009292
Nucleotide Accession#:
NM_007308
Swissprot Id:
P37840-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Alpha-synuclein
Protein Size (# AA):
112
Molecular Weight:
11kDa
Application:
WB
Immunogen:
The immunogen for anti-SNCA antibody: synthetic peptide directed towards the middle region of human SNCA
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SNCA antibody - middle region (ARP42350_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Dog, Horse, Sheep, Rabbit, Guinea pig, Human, Mouse, Rat
Datasheets / Downloads:
Printable datasheet for
anti-SNCA antibody
- ARP42350_P050
Peptide Sequence:
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Blocking Peptide:
For anti-SNCA antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705)
Key Reference:
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SNCA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question