website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SNCA antibody - middle region (ARP42350_P050)

Description of Target:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.
Gene Symbol:
SNCA
Official Gene Full Name:
Synuclein, alpha (non A4 component of amyloid precursor)
NCBI Gene Id:
6622
Alias Symbols:
MGC110988; NACP; PARK1; PARK4; PD1
Tissue Tool:
Find tissues and cell lines supported to express SNCA.
Protein Accession #:
NP_009292
Nucleotide Accession#:
NM_007308
Swissprot Id:
P37840-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Alpha-synuclein
Protein Size (# AA):
112
Molecular Weight:
11kDa
Application:
WB
Immunogen:
The immunogen for anti-SNCA antibody: synthetic peptide directed towards the middle region of human SNCA
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SNCA antibody - middle region (ARP42350_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Dog, Horse, Sheep, Rabbit, Guinea pig, Human, Mouse, Rat
Datasheets / Downloads:
Printable datasheet for
anti-SNCA antibody
- ARP42350_P050
Peptide Sequence:
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Blocking Peptide:
For anti-SNCA antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705)
Target Reference:
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SNCA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for SNCA antibody (ARP42350)

Product page for SNCA antibody (ARP42350)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SNCA antibody; Loxodonta africana SNCA antibody G3T7Z3 100%
Black-handed spider monkey SYUA antibody; Ateles geoffroyi SYUA antibody P61138 100%
Bovine SNCA antibody; Bos taurus SNCA antibody Q8HZ79 100%
Bovine SNCA antibody; Bos taurus SNCA antibody A6QQ08 100%
Bovine SYUA antibody; Bos taurus SYUA antibody Q3T0G8 100%
Chimpanzee SYUA antibody; Pan troglodytes SYUA antibody P61145 100%
Common squirrel monkey SNCA antibody; Saimiri sciureus SNCA antibody D0FH84 100%
Common woolly monkey SYUA antibody; Lagothrix lagotricha SYUA antibody P61141 100%
Crab-eating macaque SYUA antibody; Macaca fascicularis SYUA antibody P61142 100%
Dog SNCA antibody; Canis familiaris SNCA antibody E2RQW7 100%
Dog SNCA antibody; Canis familiaris SNCA antibody E2RQW5 100%
Dog SNCA antibody; Canis familiaris SNCA antibody E2RDD9 100%
Giant panda LOC100478316 antibody; Ailuropoda melanoleuca LOC100478316 antibody G1M951 100%
Guinea pig LOC100725375 antibody; Cavia porcellus LOC100725375 antibody H0VPZ2 100%
Horse SNCA antibody; Equus caballus SNCA antibody F6U044 100%
Human SYUA antibody; Homo sapiens SYUA antibody P37840-2 100%
Human SYUA antibody; Homo sapiens SYUA antibody P37840 100%
Human SYUA antibody; Homo sapiens SYUA antibody P37840-3 100%
Lowland gorilla SYUA antibody; Gorilla gorilla gorilla SYUA antibody P61140 100%
Mouse SYUA antibody; Mus musculus SYUA antibody O55042 100%
Northern white-cheeked gibbon LOC100601557 antibody; Nomascus leucogenys LOC100601557 antibody G1RW17 100%
Northern white-cheeked gibbon SNCA antibody; Nomascus leucogenys SNCA antibody G1RW21 100%
Northern white-cheeked gibbon SNCA antibody; Nomascus leucogenys SNCA antibody G1RW19 100%
Pig SNCA antibody; Sus scrofa SNCA antibody Q3I5G7 100%
Pig SNCA antibody; Sus scrofa SNCA antibody Q4PNS0 100%
Pygmy chimpanzee SYUA antibody; Pan paniscus SYUA antibody P61144 100%
Rabbit LOC100359228 antibody; Oryctolagus cuniculus LOC100359228 antibody G1U0V2 100%
Rat SYUA antibody; Rattus norvegicus SYUA antibody P37377 100%
Red guenon SYUA antibody; Erythrocebus patas SYUA antibody P61139 100%
Red-chested mustached tamarin SYUA antibody; Saguinus labiatus SYUA antibody P61147 100%
Rhesus macaque SNCA antibody; Macaca mulatta SNCA antibody F7H8L8 100%
Rhesus macaque SYUA antibody; Macaca mulatta SYUA antibody P61143 100%
Sheep SNCA antibody; Ovis aries SNCA antibody G1EFI2 100%
Sumatran orangutan SYUA antibody; Pongo abelii SYUA antibody P61146 100%
White-tufted-ear marmoset LOC100406180 antibody; Callithrix jacchus LOC100406180 antibody F7HDN5 100%
White-tufted-ear marmoset LOC100406180 antibody; Callithrix jacchus LOC100406180 antibody F7GY62 100%
White-tufted-ear marmoset LOC100406180 antibody; Callithrix jacchus LOC100406180 antibody F7HDW6 92%

Product Protocols: SNCA antibody tested with Human Hepg2 Cells (ARP42350_P050)

Aviva Systems Biology is the original manufacturer of this SNCA antibody (ARP42350_P050)

Click here to view the SNCA antibody Western Blot Protocol

Product Datasheet Link: SNCA antibody (ARP42350_P050)

WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SNCA antibody (ARP42350_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question