website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

SNCA antibody - middle region (ARP42350_P050)

Description of Target:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.
Gene Symbol:
Official Gene Full Name:
Synuclein, alpha (non A4 component of amyloid precursor)
NCBI Gene Id:
Alias Symbols:
MGC110988; NACP; PARK1; PARK4; PD1
Tissue Tool:
Find tissues and cell lines supported to express SNCA.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
NEDD4L; UBC; NEDD4; SNCA; GAPDH; HPRT1; CHMP5; KLK6; PARK7; LAMP2; CDC5; SLG1; PLK2; SAC7; TUS1; ROM2; MID2; Csnk2b; Lyn; Fgr; Csnk1g3; Syk; Rab5a; YWHAQ; ARPP19; RABAC1; TUBA1B; CALM; ACTA1; HIST2H3C; TUBB1; BDH2; USP47; SAP30BP; PELP1; SIN3A; Rab3a; ENC
The immunogen for anti-SNCA antibody: synthetic peptide directed towards the middle region of human SNCA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
SNCA antibody - middle region (ARP42350_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Dog, Horse, Sheep, Rabbit, Guinea pig, Human, Mouse, Rat
Datasheets / Downloads:
Printable datasheet for
anti-SNCA antibody
- ARP42350_P050
Peptide Sequence:
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Blocking Peptide:
For anti-SNCA antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705)
Target Reference:
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SNCA antibody tested with Human Hepg2 Cells (ARP42350_P050)

Aviva Systems Biology is the original manufacturer of this SNCA antibody (ARP42350_P050)

Click here to view the SNCA antibody Western Blot Protocol

Product Datasheet Link: SNCA antibody (ARP42350_P050)

WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:

Description of Target: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SNCA antibody (ARP42350_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question