website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

SNCA antibody - middle region (ARP42350_P050)

Description of Target:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.
Gene Symbol:
SNCA
Official Gene Full Name:
Synuclein, alpha (non A4 component of amyloid precursor)
NCBI Gene Id:
6622
Alias Symbols:
MGC110988; NACP; PARK1; PARK4; PD1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNCA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNCA.
Swissprot Id:
P37840-2
Protein Accession #:
NP_009292
Nucleotide Accession #:
NM_007308
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Alpha-synuclein
Protein Size (# AA):
112
Molecular Weight:
11kDa
Application:
WB
Protein Interactions:
NEDD4L; UBC; NEDD4; SNCA; GAPDH; HPRT1; CHMP5; KLK6; PARK7; LAMP2; CDC5; SLG1; PLK2; SAC7; TUS1; ROM2; MID2; Csnk2b; Lyn; Fgr; Csnk1g3; Syk; Rab5a; YWHAQ; ARPP19; RABAC1; TUBA1B; CALM; ACTA1; HIST2H3C; TUBB1; BDH2; USP47; SAP30BP; PELP1; SIN3A; Rab3a; ENC
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SNCA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-SNCA (ARP42350_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-SNCA (ARP42350_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Blocking Peptide:
For anti-SNCA (ARP42350_P050) antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705)
Target Reference:
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SNCA antibody tested with Human Hepg2 Cells (ARP42350_P050)

Aviva Systems Biology is the original manufacturer of this SNCA antibody (ARP42350_P050)

Click here to view the SNCA antibody Western Blot Protocol

Product Datasheet Link: SNCA antibody (ARP42350_P050)

WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SNCA antibody (ARP42350_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question