SMARCA3 Antibody - C-terminal region (ARP38218_T100)

Catalog No: ARP38218_T100

WB Suggested Anti-SMARCA3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCA3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-HLTF (ARP38218_T100) antibody is Catalog # AAP38218 (Previous Catalog # AAPP20394)
• Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Target Info

• Gene Symbol: HLTF
• Gene Full Name: Helicase-like transcription factor
• Alias Symbols: ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, SMARCA3
• NCBI Gene Id: 6596
• Protein Name: Helicase-like transcription factor
• Description of Target: SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.
• Uniprot ID: Q14527
• Protein Accession #: NP_620636
• Nucleotide Accession #: NM_139048
• Protein Size (# AA): 1009
• Molecular Weight: 114kDa
• Protein Interactions: CHFR; UBC; RAD18; SUMO2; RPA3; RPA2; RPA1; WBP4; BRCA1; DTL; SULT1C2; HSPA8; CDK9; NOTCH1; SP3; SP1; SPRTN; Cebpb; ELAVL1; Shprh; RNF146; tat; EWSR1; UBE2Z; RPAP1; USP7; EEF1G; UBE2V2; UBE2N; PCNA;