SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63651_P050
Price: $0.00
SKU
ARP63651_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC7A5 (ARP63651_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC7A5 (ARP63651_P050) antibody is Catalog # AAP63651
Sample Type Confirmation

SLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, HepG2

Subunit1
Gene SymbolSLC7A5
Gene Full NameSolute carrier family 7 (amino acid transporter light chain, L system), member 5
Alias SymbolsE16, CD98, LAT1, 4F2LC, MPE16, D16S469E
NCBI Gene Id8140
Protein NameLarge neutral amino acids transporter small subunit 1
Description of TargetSLC7A5 is a sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. SLC7A5 is involved in cellular amino acid uptake. SLC7A5 acts as an amino acid exchanger. SLC7A5 is involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. SLC7A5 plays a role in neuronal cell proliferation (neurogenesis) in brain. SLC7A5 is involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. SLC7A5 is involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. SLC7A5 may play an important role in high-grade gliomas. SLC7A5 mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. SLC7A5 acts as the major transporter of tyrosine in fibroblasts.
Uniprot IDQ01650
Protein Accession #NP_003477
Nucleotide Accession #NM_003486
Protein Size (# AA)507
Molecular Weight56kDa
Protein InteractionsUBC; SUMO2; LGR4; NOS2; HNRNPU; ELAVL1; SLC3A2;
  1. What is the species homology for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC7A5 Antibody - N-terminal region (ARP63651_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    This target may also be called "E16, CD98, LAT1, 4F2LC, MPE16, D16S469E" in publications.

  5. What is the shipping cost for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC7A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC7A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC7A5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC7A5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC7A5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC7A5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC7A5 Antibody - N-terminal region (ARP63651_P050)
Your Rating
We found other products you might like!