SLC26A3 Antibody - middle region (ARP31608_P050)

Catalog No: ARP31608_P050

WB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Host: Rabbit
Target Name: SLC26A3
Sample Type: HepG2
Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Rabbit Anti-SLC26A3 Antibody
Catalog Number: ARP31608_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult liver
Observed Staining: Cytoplasmic,Nuclear
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.

Rabbit Anti-SLC26A3 Antibody
Catalog Number: ARP31608_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Membrane
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC26A3 (ARP31608_P050) antibody is Catalog # AAP31608 (Previous Catalog # AAPP02389)
• Sample Type Confirmation:

  SLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  SPR Affinity Characterization

• Reference: Dorwart,M.R., (2008) J. Biol. Chem. 283 (13), 8711-8722

Target Info

• Gene Symbol: SLC26A3
• Gene Full Name: Solute carrier family 26, member 3
• Alias Symbols: CLD, DRA
• NCBI Gene Id: 1811
• Protein Name: Chloride anion exchanger
• Description of Target: SLC26A3 is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P40879
• Protein Accession #: NP_000102
• Nucleotide Accession #: NM_000111
• Protein Size (# AA): 764
• Molecular Weight: 84 kDa
• Protein Interactions: SLC9A3R1; SLC9A3R2;