website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

SLC18A2 antibody - N-terminal region (ARP43845_P050)

Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 2
NCBI Gene Id:
Alias Symbols:
MGC120477; MGC120478; MGC26538; SVAT; SVMT; VAT2; VMAT2
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC18A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC18A2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Synaptic vesicular amine transporter
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-SLC18A2 (ARP43845_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Guinea pig: 86%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Human, Mouse, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for anti-SLC18A2 (ARP43845_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Blocking Peptide:
For anti-SLC18A2 (ARP43845_P050) antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Target Reference:
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for SLC18A2 Antibody (ARP43845_P050) tested with human cortex in Immunohistochemistry


IHC protocol:

Antibodies were tested in the range of 2 – 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat.

Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacture’s recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using MVS Pacific anti-fade mounting media (available for OEM) with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Product Protocols: SLC18A2 antibody tested with Human Jurkat Cells (ARP43845_P050)

Aviva Systems Biology is the original manufacturer of this SLC18A2 antibody (ARP43845_P050)

Click here to view the SLC18A2 antibody Western Blot Protocol

Product Datasheet Link: SLC18A2 antibody (ARP43845_P050)

WB Suggested Anti-SLC18A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SLC18A2 antibody (ARP43845_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question