website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SLC18A2 antibody - N-terminal region (ARP43845_P050)

Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Gene Symbol:
SLC18A2
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 2
NCBI Gene Id:
6571
Alias Symbols:
MGC120477; MGC120478; MGC26538; SVAT; SVMT; VAT2; VMAT2
Tissue Tool:
Find tissues and cell lines supported to express SLC18A2.
Protein Accession #:
NP_003045
Nucleotide Accession#:
NM_003054
Swissprot Id:
Q05940
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Synaptic vesicular amine transporter
Protein Size (# AA):
514
Molecular Weight:
56kDa
Application:
IHC, WB
Partner Proteins:
POU2AF1
Immunogen:
The immunogen for anti-SLC18A2 antibody: synthetic peptide directed towards the N terminal of human SLC18A2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SLC18A2 antibody - N-terminal region (ARP43845_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Guinea pig: 86%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Human, Mouse, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC18A2 antibody
- ARP43845_P050
Peptide Sequence:
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Blocking Peptide:
For anti-SLC18A2 antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Key Reference:
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SLC18A2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question