website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC18A2 antibody - N-terminal region (ARP43845_P050)

Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
$289.00
In Stock
Free trial-size samples may be available for this item. Please go here for more information.
Gene Symbol:
SLC18A2
NCBI Gene Id:
6571
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 2
Protein Name:
Synaptic vesicular amine transporter
Swissprot Id:
Q05940
Protein Accession #:
NP_003045
Nucleotide Accession #:
NM_003054
Alias Symbols:
MGC120477, MGC120478, MGC26538, SVAT, SVMT, VAT2, VMAT2
Replacement Item:
This antibody may replace item sc-15314 from Santa Cruz Biotechnology.
Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Protein Size (# AA):
514
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC18A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC18A2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC18A2 (ARP43845_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PARK7; UBC; CSNK1A1; CSNK2A2; CSNK2A1;
Blocking Peptide:
For anti-SLC18A2 (ARP43845_P050) antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Datasheets / Downloads:
Printable datasheet for anti-SLC18A2 (ARP43845_P050) antibody
Target Reference:
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191

Customer Reviews for SLC18A2 Antibody (ARP43845_P050) tested with human cortex in Immunohistochemistry

CAT#ARP43845

IHC protocol:

Antibodies were tested in the range of 2 – 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat.

Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacture's recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using MVS Pacific anti-fade mounting media (available for OEM) with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Product Protocols: SLC18A2 antibody tested with Human Jurkat Cells (ARP43845_P050)

Aviva Systems Biology is the original manufacturer of this SLC18A2 antibody (ARP43845_P050)

Click here to view the SLC18A2 antibody Western Blot Protocol

Product Datasheet Link: SLC18A2 antibody (ARP43845_P050)

WB Suggested Anti-SLC18A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SLC18A2 antibody (ARP43845_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question