website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SLC18A2 antibody - N-terminal region (ARP43845_P050)

Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 2
NCBI Gene Id:
Alias Symbols:
MGC120477; MGC120478; MGC26538; SVAT; SVMT; VAT2; VMAT2
Tissue Tool:
Find tissues and cell lines supported to express SLC18A2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Synaptic vesicular amine transporter
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-SLC18A2 antibody: synthetic peptide directed towards the N terminal of human SLC18A2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
SLC18A2 antibody - N-terminal region (ARP43845_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Guinea pig: 86%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Human, Mouse, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC18A2 antibody
- ARP43845_P050
Peptide Sequence:
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Blocking Peptide:
For anti-SLC18A2 antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Target Reference:
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for SLC18A2 Antibody (ARP43845_P050) tested with human cortex in Immunohistochemistry


IHC protocol:

Antibodies were tested in the range of 2 – 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat.

Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacture’s recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using MVS Pacific anti-fade mounting media (available for OEM) with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Computational species homology for SLC18A2 antibody (ARP43845)

Product page for SLC18A2 antibody (ARP43845)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SLC18A2 antibody; Loxodonta africana SLC18A2 antibody G3TFU9 92%
Bovine SLC18A2 antibody; Bos taurus SLC18A2 antibody B0JYP2 100%
Bovine VMAT2 antibody; Bos taurus VMAT2 antibody Q27963 100%
Chicken SLC18A2 antibody; Gallus gallus SLC18A2 antibody F1P4R2 92%
Common turkey SLC18A2 antibody; Meleagris gallopavo SLC18A2 antibody G1NFI4 92%
Dog SLC18A2 antibody; Canis familiaris SLC18A2 antibody F1PD81 85%
Duckbill platypus SLC18A2 antibody; Ornithorhynchus anatinus SLC18A2 antibody F6UQM2 92%
Duckbill platypus SLC18A2 antibody; Ornithorhynchus anatinus SLC18A2 antibody F6UQK8 92%
Duckbill platypus SLC18A2 antibody; Ornithorhynchus anatinus SLC18A2 antibody F6UQJ8 92%
Gray short-tailed opossum SLC18A2 antibody; Monodelphis domestica SLC18A2 antibody F7BLF1 78%
Gray short-tailed opossum SLC18A2 antibody; Monodelphis domestica SLC18A2 antibody F7BLD7 78%
Guinea pig LOC100719098 antibody; Cavia porcellus LOC100719098 antibody H0V186 85%
Horse SLC18A2 antibody; Equus caballus SLC18A2 antibody F6WRN1 100%
Human SLC18A2 antibody; Homo sapiens SLC18A2 antibody Q99870 100%
Human SLC18A2 antibody; Homo sapiens SLC18A2 antibody Q4G147 100%
Human VMAT2 antibody; Homo sapiens VMAT2 antibody Q05940 100%
Little brown bat SLC18A2 antibody; Myotis lucifugus SLC18A2 antibody G1P306 92%
Lowland gorilla SLC18A2 antibody; Gorilla gorilla gorilla SLC18A2 antibody G3QP15 100%
Mouse Slc18a2 antibody; Mus musculus Slc18a2 antibody Q66L40 100%
Mouse VMAT2 antibody; Mus musculus VMAT2 antibody Q8BRU6 100%
Northern white-cheeked gibbon SLC18A2 antibody; Nomascus leucogenys SLC18A2 antibody G1S3N7 100%
Rabbit SLC18A2 antibody; Oryctolagus cuniculus SLC18A2 antibody G1T2K3 100%
Rat VMAT2 antibody; Rattus norvegicus VMAT2 antibody Q01827 92%
Rhesus macaque SLC18A2 antibody; Macaca mulatta SLC18A2 antibody F6VXD8 100%
Small-eared galago SLC18A2 antibody; Otolemur garnettii SLC18A2 antibody H0XPA3 92%
Tasmanian devil SLC18A2 antibody; Sarcophilus harrisii SLC18A2 antibody G3WVI8 92%
White-tufted-ear marmoset LOC100395730 antibody; Callithrix jacchus LOC100395730 antibody F7EIF3 100%
Zebra finch SLC18A2 antibody; Taeniopygia guttata SLC18A2 antibody H0ZLD6 76%

Product Protocols: SLC18A2 antibody tested with Human Jurkat Cells (ARP43845_P050)

Aviva Systems Biology is the original manufacturer of this SLC18A2 antibody (ARP43845_P050)

Click here to view the SLC18A2 antibody Western Blot Protocol

Product Datasheet Link: SLC18A2 antibody (ARP43845_P050)

WB Suggested Anti-SLC18A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SLC18A2 antibody (ARP43845_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question