SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32294_P050
Price: $0.00
SKU
ARP32294_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SNW1 (ARP32294_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
Peptide SequenceSynthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
Concentration0.5 mg/ml
Blocking PeptideFor anti-SNW1 (ARP32294_P050) antibody is Catalog # AAP32294 (Previous Catalog # AAPP03276)
Sample Type Confirmation

SNW1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceFigueroa,J.D., et al., (2004) Eur.Res.Commun.319(4),1105-1109
Gene SymbolSNW1
Gene Full NameSNW domain containing 1
Alias SymbolsBx42, SKIP, FUN20, Prp45, SKIIP, SKIP1, PRPF45, NCOA-62
NCBI Gene Id22938
Protein NameSNW domain-containing protein 1
Description of TargetSKIIP (Nuclear Protein SkiP, nuclear receptor coactivator NCoA-62, ski-interacting protein) is a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also interact with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
Uniprot IDQ13573
Protein Accession #NP_036377
Nucleotide Accession #NM_012245
Protein Size (# AA)536
Molecular Weight61kDa
Protein InteractionsTRAF1; GOLGA2; KRT40; LZTS2; RINT1; TEX11; CEP55; PPIL1; TFIP11; MTUS2; IKZF1; TP53; TUBGCP3; AURKB; UBC; SUZ12; RNF2; BMI1; HECW2; HDAC11; Dlg4; TTC14; ZNF830; SNIP1; CXorf56; XAB2; CTNNBL1; SART1; NHP2L1; MFAP1; EIF4A3; MAGOH; DHX15; DDX5; PABPC1; SKIV2
  1. What is the species homology for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast".

  2. How long will it take to receive "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SKIIP Antibody - N-terminal region (ARP32294_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    This target may also be called "Bx42, SKIP, FUN20, Prp45, SKIIP, SKIP1, PRPF45, NCOA-62" in publications.

  5. What is the shipping cost for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SKIIP Antibody - N-terminal region (ARP32294_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SNW1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SNW1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SNW1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SNW1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SNW1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SNW1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SKIIP Antibody - N-terminal region (ARP32294_P050)
Your Rating