SIGLEC12 Antibody - N-terminal region (ARP50236_P050)

Catalog No: ARP50236_P050

WB Suggested Anti-SIGLEC12 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIGLEC12
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIGLEC12 (ARP50236_P050) antibody is Catalog # AAP50236 (Previous Catalog # AAPP29689)
• Reference: Angata,T., (2001) J. Biol. Chem. 276 (43), 40282-40287

Target Info

• Gene Symbol: SIGLEC12
• Gene Full Name: Sialic acid binding Ig-like lectin 12 (gene/pseudogene)
• Alias Symbols: S2V, SLG, SIGLECL1, Siglec-XII
• NCBI Gene Id: 89858
• Protein Name: Sialic acid-binding Ig-like lectin 12
• Description of Target: Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions of this protein target confirm the same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene.
• Uniprot ID: Q96PQ1
• Protein Accession #: NP_443729
• Nucleotide Accession #: NM_053003
• Protein Size (# AA): 595
• Molecular Weight: 63kDa
• Protein Interactions: CMAS; PTPN6; PTPN11;