SIGLEC10 Antibody - middle region (ARP50160_P050)

Catalog No: ARP50160_P050

WB Suggested Anti-SIGLEC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIGLEC10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIGLEC10 (ARP50160_P050) antibody is Catalog # AAP50160 (Previous Catalog # AAPY02784)
• Reference: Szafranski,K., Genome Biol. 8 (8), R154 (2007)

Target Info

• Gene Symbol: SIGLEC10
• Gene Full Name: Sialic acid binding Ig-like lectin 10
• Alias Symbols: SLG2, PRO940, SIGLEC-10
• NCBI Gene Id: 89790
• Protein Name: Sialic acid-binding Ig-like lectin 10
• Description of Target: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-653 AC008750.9 90495-91147 c 654-760 DA387605.1 391-497 761-2959 AF301007.1 262-2460 2960-3794 AY358337.1 1930-2764
• Uniprot ID: Q96LC7
• Protein Accession #: NP_149121
• Nucleotide Accession #: NM_033130
• Protein Size (# AA): 697
• Molecular Weight: 76kDa
• Protein Interactions: FLNA; PTPN6;