Catalog No: ARP35054_P050
Price: $0.00
SKU
ARP35054_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SHROOM2 (ARP35054_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SHROOM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
Concentration0.5 mg/ml
Blocking PeptideFor anti-SHROOM2 (ARP35054_P050) antibody is Catalog # AAP35054 (Previous Catalog # AAPP06281)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolSHROOM2
Gene Full NameShroom family member 2
Alias SymbolsAPXL, HSAPXL
NCBI Gene Id357
Protein NameProtein Shroom2
Description of TargetSHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
Uniprot IDQ13796
Protein Accession #NP_001640
Nucleotide Accession #NM_001649
Protein Size (# AA)1616
Molecular Weight176 kDa
Protein InteractionsYWHAE; YWHAG;
  1. What is the species homology for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SHROOM2 Antibody - middle region (ARP35054_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    This target may also be called "APXL, HSAPXL" in publications.

  5. What is the shipping cost for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "176 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SHROOM2 Antibody - middle region (ARP35054_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SHROOM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SHROOM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SHROOM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SHROOM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SHROOM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SHROOM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SHROOM2 Antibody - middle region (ARP35054_P050)
Your Rating