SFXN4 Antibody - N-terminal region (ARP53530_P050)

Catalog No: ARP53530_P050

WB Suggested Anti-SFXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFXN4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SFXN4 (ARP53530_P050) antibody is Catalog # AAP53530 (Previous Catalog # AAPP42328)

Target Info

• Gene Symbol: SFXN4
• Gene Full Name: Sideroflexin 4
• Alias Symbols: BCRM1, COXPD18, SLC56A4
• NCBI Gene Id: 119559
• Protein Name: Sideroflexin-4
• Description of Target: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
• Uniprot ID: Q6P4A7
• Protein Accession #: NP_998814
• Nucleotide Accession #: NM_213649
• Protein Size (# AA): 337
• Molecular Weight: 38kDa
• Protein Interactions: UBC; CLN3; BABAM1;