Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP40632_P050
Price: $0.00
SKU
ARP40632_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SRSF6 (ARP40632_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SFRS6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 82%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS
Concentration0.5 mg/ml
Blocking PeptideFor anti-SRSF6 (ARP40632_P050) antibody is Catalog # AAP40632 (Previous Catalog # AAPP22392)
Sample Type Confirmation

SRSF6 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceEwing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Publications

Gautrey, H. L. & Tyson-Capper, A. J. Regulation of Mcl-1 by SRSF1 and SRSF5 in cancer cells. PLoS One 7, e51497 (2012). 23284704

Gene SymbolSRSF6
Gene Full NameSerine/arginine-rich splicing factor 6
Alias SymbolsB52, SFRS6, SRP55, HEL-S-91
NCBI Gene Id6431
Protein NameSerine/arginine-rich splicing factor 6
Description of TargetSFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ13247
Protein Accession #NP_006266
Nucleotide Accession #NM_006275
Protein Size (# AA)344
Molecular Weight40 kDa
Protein InteractionsLUC7L2; TP53; MDM2; ASB18; SUZ12; EED; RPL24; SRPK2; SRPK1; SRPK3; TARDBP; YWHAE; PAN2; TOE1; SF3B4; RBM10; UBC; TRA2B; EIF4A3; MAGOH; ESR1; BARD1; SRSF10; APP; CAND1; COPS5; SRRM1; CUL1; CUL2; TERF2; TERF1; HNRNPA1; SF3A2; ELAVL1; SREK1; AI837181; CLK1;
  1. What is the species homology for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SFRS6 Antibody - middle region (ARP40632_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SFRS6 Antibody - middle region (ARP40632_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    This target may also be called "B52, SFRS6, SRP55, HEL-S-91" in publications.

  5. What is the shipping cost for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SFRS6 Antibody - middle region (ARP40632_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SRSF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SRSF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SRSF6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SRSF6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SRSF6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SRSF6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SFRS6 Antibody - middle region (ARP40632_P050)
Your Rating